SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011999 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011999
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily Cyclophilin-like 4.53e-67
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011999   Gene: ENSMLUG00000013189   Transcript: ENSMLUT00000013190
Sequence length 160
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:6093671:6098408:-1 gene:ENSMLUG00000013189 transcript:ENSMLUT00000013190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVTLHTDVGDIKIEIFCERTPKACENFLALCASNYYNGCIFHRNIKGFMVQTGDPSGTGR
GGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKV
IDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ
Download sequence
Identical sequences G1PM83
ENSMLUP00000011999 ENSMLUP00000011999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]