SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012079 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012079
Domain Number 1 Region: 4-288
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.35e-64
Family BAR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 408-522
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.66e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00021
Further Details:      
 
Domain Number 3 Region: 261-362
Classification Level Classification E-value
Superfamily PH domain-like 1.71e-26
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 4 Region: 586-693
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.42e-23
Family Ankyrin repeat 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012079   Gene: ENSMLUG00000013263   Transcript: ENSMLUT00000013276
Sequence length 740
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430457:92844:105633:1 gene:ENSMLUG00000013263 transcript:ENSMLUT00000013276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVKLDFEECLKDSPRFRASVELVEAEVSELETRLEKLLKLGNGLLESGRHYVAAGRAFV
VGICDLARLGPPEPMMAECLEKFTESLNHKLDSHAELLDATQHTLQQQIQALVKEGLRGF
REARRDFWRGAESLETALTHNAEVPRRRAQEAEEAGAALKTARAGYRGRALDYALQINVI
EDKRKFDIMEFALRLVEAQATHFQQGHEELSRLAQYRKELGAQLHQLVLNSARQKRDMEQ
RHVLLKQKELGGEEPEPSLKEGPGGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKK
YKDPVTVVVDDLRLCTVKLCPDSERRFCFEVVSPSKSCFLQADSERLLQLWVSAVQSSIA
TAFNQSRLDDSPRGSGQGSGHLVMGSAATLGPGGTTRGREPGGVGHVAAQVQSVDGNAQC
CDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVV
INQIYEARVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGPPRGQP
PVPPKPSLKPQPGSCRSKSEPPPDNLGSLHPGALLFRAAGHPPSLPTMADALAHGADVNW
VNTGQENATPLIQATAANSLLACEFLLQNGANVNQADSRGRGPLHHATILGHTGLACLFL
KRGADLGAQDSEGRDPLTIAMETANADIVTLLRLAKMREAEAAQGQAGDETYLDIFRDFS
LMASDDPEKLSRRAQDLHTL
Download sequence
Identical sequences G1PMF3
ENSMLUP00000012079 ENSMLUP00000012079 XP_014303126.1.53796 XP_014303127.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]