SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012100 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012100
Domain Number 1 Region: 118-377
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-65
Family Protein kinases, catalytic subunit 0.00000117
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000012100
Domain Number - Region: 606-634
Classification Level Classification E-value
Superfamily UBA-like 0.0181
Family UBA domain 0.083
Further Details:      
 
Domain Number - Region: 629-662
Classification Level Classification E-value
Superfamily UBA-like 0.0357
Family UBA domain 0.039
Further Details:      
 
Domain Number - Region: 394-445
Classification Level Classification E-value
Superfamily SH3-domain 0.0986
Family SH3-domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012100   Gene: ENSMLUG00000013295   Transcript: ENSMLUT00000013300
Sequence length 669
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430457:121844:131302:1 gene:ENSMLUG00000013295 transcript:ENSMLUT00000013300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPEAGAPWLLRLLRDTQLAQFYRSILEELNVTRPEHFDFVRPEDLDSIGMGRPAQRRLA
EALKRHRLGHKPKNWVYKILGGLAPEQKETTPPSDNPPSLPEPEGGLKCLIPDGAVCRGE
LLGSGCFGVVHRGLWTLPSGQSVPVAVKSLRVAAEGSAGTELRDFLREVSVMMNLEHPHL
LRLHGLVLGQPLQMVMELAPLGSLHARLTAPAPAPPLPVALLCLFLRQLAGAMAYLGARG
LVHRDLATRNLLLTSPCTIKVADFGLVRPLGGARGRYVMGGPRPIPYAWCAPESLRQGAF
SSASDVWMFGVTLWEMFSRGKEPWAWVPPYLILQRLEKDQARLPRPPLCSRALYTLALRC
WALHPADRPSFSSLEGLIQEAWPPEGRCVRDVSEPGALRMECGDPITIIEGRFSPSFRSP
SSTTWKGQNGRTLKVGSFPASAVTLTDLKGSPATCPVHRDSPAWGEQRRGSADGARAKAK
LREPPPAQGQRRNMPLQRRKGISKSLESVLSLGPCPTGGGLSPPELRKARDVPQGPPGLP
PRPPFASGSSQSNQPPRERPSWPKREPLHSHPLGAPGASKAAVLSGGLLPDPDLQKRVME
VELSVHGVTHQECQAALRATGGDVVSAIQNLKVDQLFHLTSRSRADCRHILEHYHWDLSA
ASRYVLARP
Download sequence
Identical sequences G1PMH1
ENSMLUP00000012100 ENSMLUP00000012100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]