SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012109 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012109
Domain Number 1 Region: 51-96
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 1.57e-17
Family Cysteine-rich DNA binding domain, (DM domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 241-284
Classification Level Classification E-value
Superfamily UBA-like 0.00000153
Family CUE domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012109   Gene: ENSMLUG00000013312   Transcript: ENSMLUT00000013310
Sequence length 421
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430038:1704692:1709839:-1 gene:ENSMLUG00000013312 transcript:ENSMLUT00000013310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPGIPLPPTFLRPPSLFLRAAAAASPAGSAASRPARGLERGGGRAGLRLPTPKCARCRNH
GVVSALKGHKRFCRWRDCACAKCTLIAERQRVMAAQVALRRQQAQEESEAGGLQRLLYSG
PSPSGPGGRTSAIGFSSSYRGKNFTSPPCENTESRIIDSSFFSFPPEHKPVGVIGKHNLR
SSVSENSTKEDSVVSPHPGEQSGGEESPRSLSSSDLESGNESEWAKNFTAPRSRLRTVSS
RPRDPLDILTKIFPSYRRSRLEGILQFCKGDVVQAIEQVLNGKEHQPDSGDLASSGELGN
AAFQRASNFSLAGIGFGTLGNKSAFSPLQTSSASYGRDSSLYSLSPRLGISPLRLAYSSP
GRGLLPGFMSPYLTPGLVPALPFHPALDYAFSGMIRDASHHPSKDSVTGSRLCSRLTQDN
L
Download sequence
Identical sequences G1PMI0
ENSMLUP00000012109 ENSMLUP00000012109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]