SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012162 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012162
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.31e-33
Family PB1 domain 0.00013
Further Details:      
 
Domain Number 2 Region: 111-229
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-23
Family PDZ domain 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012162   Gene: ENSMLUG00000013370   Transcript: ENSMLUT00000013368
Sequence length 350
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429982:947757:957221:-1 gene:ENSMLUG00000013370 transcript:ENSMLUT00000013368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLLPINNDDNYHKAV
STANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVLRPDNHRKKPHIVISMPQDFRPV
SSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGL
AQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRNNVVRNSRTS
GSSGQSTDNSLLGYPQQMEPSFEPEDEDSDEDDIVIEDNGVPQQIPKAVPNTESLESLTQ
MELNLESGQNGFIPSNEVSLTTAASGTDTEFETRVPNQKLLEEDGTIITL
Download sequence
Identical sequences G1PMN0
ENSMLUP00000012162 ENSMLUP00000012162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]