SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012190 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012190
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-23
Family GRAM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012190   Gene: ENSMLUG00000013399   Transcript: ENSMLUT00000013401
Sequence length 318
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430006:228955:239948:-1 gene:ENSMLUG00000013399 transcript:ENSMLUT00000013401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNQNHTENRRKPYIPYGESVLNQCSDVELSFPEQPPGSNFFHGTKRGTLLLTSYRVIF
VTSHSVDDPMLSFMMPFDLMSNCTLEQPVFAPNYIQGTIQAAPDGGWEGQATFKLSFRKG
GAITFFQLMMKAASAAAEGTPLQSLTYWFGAPELFIVSGQGSMCNQQRSCPAGYGPPPPG
YGPPPPGYGPPPAGYGPPPPGYGPPPAGYGPPPPGYGPPPPGYGPPPPGYEAPPPGYEAP
PPGYEAPPQGYEAPPPGYEAPPPGYEAPPQGYEAPPQGYEAPPQGYEAPPAGNRAGSHNP
EAAQPDGYDASLPSTSSP
Download sequence
Identical sequences G1PMQ5
ENSMLUP00000012190 ENSMLUP00000012190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]