SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012191 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012191
Domain Number 1 Region: 679-769,800-887
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 202-473
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.32e-36
Family FCH domain 0.072
Further Details:      
 
Domain Number 3 Region: 603-660
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012191   Gene: ENSMLUG00000013393   Transcript: ENSMLUT00000013402
Sequence length 1266
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429987:1604924:1662855:1 gene:ENSMLUG00000013393 transcript:ENSMLUT00000013402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAHKQKKTKKKHVLSSGQLSTDVTTSEMGLKSVSSNVFDPDYIKELVNDIRKFSHMLLY
LKEAILSDCFKEVIHIRLDELLRVLKSVMNKHQNLNSVDLQNAAEMLTAKVKAVNFTDVN
EENKNDLFREVFSSIETLALTFGNILTNFLMGDVGNDSLFRLPVSRESKSFENVSVESVD
SSNEKVHFSPAELDSMLLKNTDSVELALSYAKTWSKYTKNIVSWVEKKLNLELESSRNIV
KLAEATRTNFGLQEFMPLQSLFTNALLNDIESSHLLQQTIAALQANKFVQPLLGRKNEME
KQRKEMKELWKQEQNKMLETETALKKAKLLCIQRQDEYEKAKSSMFRAEEEHQCASGGLV
KNLNKQLEKKRRLEEEALQKVEEANELYKVCMTNVEERRNDVENTKREILAQLRKLVFQC
DLTLKAVTVNLFQMQQLQAASLANSLQSLCDSAKLYDPGQEYSEFVRAMNSTEEEKVDGN
VTKQLTNSSHSSGYGPADSLEDVVRLPDSSSKIDEDRCSNSADITGPSFIRSWTFGMFSD
SESTGGSSESRSLDSESISPGDFHRKLPRTPSSGTMSSADDLDEREPPSPSEQGPNSLGT
YKKTLMSKAALTHKFRKLRSPTKCRDCESIVVFQGVECEECLLVCHRKCLENLVIICGHQ
KLLGKIHLFGAEFTQVAKKEPDGIPFILKVCATEIESRALCLQGIYRVCGNKIKTEKLCQ
ALENGMQLVDISEFSAHDICDVLKLYLRQLPEPFVLFRLYKEFIDLAKEIQHVNEEQETK
KDSLEDKKWPTTCIEINRILLKSKDLLRQLPVSNFNSLHYLIVHLKRVVDHAEENKMNSK
NLGVIFGPSLIRPRPTAAPITISSLAEYSNQARLVEFLIAYSQKIFDGSLQPQDVVVCST
GGVAPQVNQGCLLKPLLSPEERDPEHFMKSLFFSSKEDIRTADSENKILETSASIEESEQ
KQNALEKCDVCLIDNKVCLHVDQELESSSQKMEDVCKTSKPFSLKSNRETNSVVERYTPR
TKIRPVSLPVERLLLLASPPHERNGRNMGNVNSDKSCKNPAFEGVNRKDTPPICFKFDSF
HQQTLQKTGEKQYEQKDLNAKTAMIVPNALQEGVMTSVRVGGDHPGNATQPSKPSTETAR
LVLERQSSDSCPPAPVRAPRTLQPQHWTTFYKPRAPTASVRGVEEKPAASSPAVSPGIAH
APQGHMLKSVPDSENAPACPMQPTTSKPKENSQEHDVPDVHPTCQRPRLKRMQQFEDLED
ETPQFV
Download sequence
Identical sequences G1PMQ6
ENSMLUP00000012191 ENSMLUP00000012191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]