SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012209 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012209
Domain Number 1 Region: 356-546
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.59e-50
Family cAMP-binding domain 0.0000000287
Further Details:      
 
Domain Number 2 Region: 89-359
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.79e-36
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012209   Gene: ENSMLUG00000013418   Transcript: ENSMLUT00000013421
Sequence length 777
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429978:2135064:2142712:-1 gene:ENSMLUG00000013418 transcript:ENSMLUT00000013421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEPRPTTGPGDRATPGLEAAPPAAPAPATATSGQIPGSAFGPEPKRRQFGTLLQPTVN
KFSLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFF
KEENSPPWIVFNVLSDTFFLLDLALNFRTGIVVEEGAEILLAPQAIRTRYLRTWFLVDLI
SSIPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIF
HMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVFINHMVNHSWGRQY
SHALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRR
QYQEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEENILGELSEPLREEIINFT
CRGLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLAR
GAQDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFET
VAMDRLCRIGKNSVLRRKRSEPSPGSSGGIMEQHLVQHDRDMVRGVQGLAPGTGARLSGK
PVLWEPLVHAPLQAAAMTSSVAIALTHQRQPLLLSPDSPATLLARSSGSPASPLVPVRAG
PLLARGPWASTSRLPAPPARTLQTSLSQAGRSQVSLLGPPPGGGGRRLGPWGRPLSASQP
SLPQRAAGDGSSGRKGSGSDRLAPSGLLAKPPGIAQLPRPPVPEPAPPRGPQLSANM
Download sequence
Identical sequences G1PMS2
XP_006097902.2.53796 XP_014319051.1.53796 ENSMLUP00000012209 ENSMLUP00000012209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]