SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012242 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012242
Domain Number 1 Region: 285-411
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-17
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000012242
Domain Number - Region: 9-64
Classification Level Classification E-value
Superfamily HR1 repeat 0.0418
Family HR1 repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012242   Gene: ENSMLUG00000013452   Transcript: ENSMLUT00000013456
Sequence length 534
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429829:2099686:2157410:-1 gene:ENSMLUG00000013452 transcript:ENSMLUT00000013456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSFFFKDCSIQEKIDLEIRMRQGIWKLLSLSTQKDQILHAVKNLMVCNARIMAYTSELQK
LEEQIANQSGRWPKYAEIPSKERTACKGKLAISDIRIPLMWKDSDHFSNKEQSQRYAIFC
LFKMGAEVFDTDMVIVDKTITDICFENVTIFNEARPDFQIKVEVYSCCTEESSITNTPRK
LAKKLKTSISKATGKKMHSVLQEDHETCLSFGSAISLPFKVVIGAKYNLLAHATLTLENA
EDNFKTHNLSINGNEESSFWLPLFGNMCCRLVAQPACMAEDAFAGFLNQQQMLEGLISWR
RLYCVLRGGKLYCFYTPEEIEAKVEPALVVPINKETRIRAMENTKKRVYNFSVTNPVSGQ
AVAHIFAADNKEDLQKWMEAFWQHFFDLSQWKHCCEKLMKIEIMSPRKPPLFLTKEATSV
YHDMSIDSPIKLESLTDIIQKKSQHEEPSPPPWAALFDGNHQVVIQKEILSPASKQLPDG
KRKKRRAPLPPPDKAPFSLKTQSNTDLLAKPVPTPRQKSIKDILDPRSWLQAQV
Download sequence
Identical sequences G1PMV1
ENSMLUP00000012242 ENSMLUP00000012242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]