SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012243 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012243
Domain Number 1 Region: 80-374
Classification Level Classification E-value
Superfamily Terpenoid synthases 3.08e-64
Family Isoprenyl diphosphate synthases 0.00000000497
Further Details:      
 
Domain Number 2 Region: 812-860
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000125
Family SH3-domain 0.0023
Further Details:      
 
Domain Number 3 Region: 453-629
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000222
Family RUN domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012243   Gene: ENSMLUG00000013446   Transcript: ENSMLUT00000013457
Sequence length 860
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429978:2100295:2166597:-1 gene:ENSMLUG00000013446 transcript:ENSMLUT00000013457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLSRWLRSVGVFLLPAPCWVPQERWLGSLQRPSLVHRGSVLGAWHSARCRCQVWTEEPR
VLYSSLRMNGDQKLDVYDQKKQNFIQHFSQIVKVLTEDDLGHPDTGDAIARLKEVLEYNV
IGGKYQRGMTVLITFQDLVEPSKQDADSLQRAMTVGWCVELLQAFFLVADDIMDSSLTRR
GQICWYQKPGIGLDAVNDAMLLEACIYRLLKLYCREQPYYLNLMELFLQTSYQTEIGQTL
DLITAPQSNVDLGRFTEKRYKSIVKYKTAFYSFYLPVAAAMYMAGIDGEKEHANAKKILL
EMGELFQIQENYGQKEAEKVARVKALYEELNLQAVFMQYEEDSYSRLLGLIEQYSSPLPQ
AIFLRLAQKIYKRKNSCSDLSPDESPISVYSRDLPGGQDVPPQPSITPPEQGSPLASAVR
SSWSFAGVPGAQRLWMAEAQSGTGQLQEQKKGLLIAVSASVDKIITHFGAARNLVQKAQL
GDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSNPWSVVEASVKPGSSTR
SFGTLYSQVSRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLLYLPTGFFS
LARGGCPSLSTELLLLLQPLSVLTFHLDLLFEHHHHLPLGPPQTPAPPGSPPALQQTVQA
MLHWGGRLAQSLRGASEETPPGPSAPSSPPKPGSWWEQLTQASRVYASGGTEGFSLRRWG
SRCPGTVAEEAQERSLPTEDTAPGRGVWLGRLFGVPGALTETESGTLKSRRPSSWLPPTV
NVLALVKRVAPSETPSSPEELEASAPSTVQTHRAVRALCDHTAAGPDQLSFQRGEVLRVI
ATVDEDWLRCGRDGMEGLVP
Download sequence
Identical sequences G1PMV2
ENSMLUP00000012243 ENSMLUP00000012243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]