SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012288 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012288
Domain Number 1 Region: 111-358
Classification Level Classification E-value
Superfamily DNase I-like 7.2e-37
Family DNase I-like 0.037
Further Details:      
 
Domain Number 2 Region: 24-62
Classification Level Classification E-value
Superfamily UBA-like 0.0000995
Family TAP-C domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012288   Gene: ENSMLUG00000013506   Transcript: ENSMLUT00000013504
Sequence length 361
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430599:285824:292494:-1 gene:ENSMLUG00000013506 transcript:ENSMLUT00000013504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAIEQKRCPEARPDDGQPAGKKRLLCTDLPSVAGCHVDVARRYLAENAWEVERALNAYF
EPRAEEGALPRRPAPPPAPGSCVDLTEEEAPDPVGSRSGSAGPPQQEDGSMFSLVTWNVD
GLDLNNLWERAQGVCASLALYSPDVIFLQEVIPPYYSLLKKKASSYEIITGNDDGYFTAI
MLKKSRVKLKSQEIIPFPNTKMMRNLLCVHASVSGNELCLMTSHLESTQGHAEERANQFK
MVLKKMQEAPESATVIFAGDTNLRDHEVTKCGGLPSNISDVWEFLGKPKHCQYTWDTQVN
SNLGIRAICKHRFDRIFFRAAAAGGSHIIPQSLDLLGLEKLGCGRFPSDHWGLLCTLDVI
L
Download sequence
Identical sequences G1PMZ3
ENSMLUP00000012288 ENSMLUP00000012288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]