SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012305 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012305
Domain Number 1 Region: 3-689
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.99e-244
Family Motor proteins 0.0000000000293
Further Details:      
 
Domain Number 2 Region: 986-1060
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000263
Family SH3-domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012305   Gene: ENSMLUG00000013511   Transcript: ENSMLUT00000013522
Sequence length 1061
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430826:6799:100579:1 gene:ENSMLUG00000013511 transcript:ENSMLUT00000013522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQTYIGSVLISVNPFKQMPYFGDKEIEMYQGAAQYENPPHIYALADNMYRNMIIDRENQC
VIISGESGAGKTVAAKYIMSYVSRVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNS
SRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASADQKQSL
GITSMDYYYYLSLSGSYKVDDIDDKREFQETLHAMNVIGIFAEEQALVLQIVAGVLHLGN
ISFKEVGNYAAVESEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQ
ACYTRDALAKALHSRVFDFLVDSINKAMEKDHEEYNIGVLDIYGFEIFQKNGFEQFCINF
VNEKLQQIFIELTLKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKVNPPGIMSILDDVC
ATMHAVGEGADQTLLQKLQMQIGNHEHFNSWNQGFIIHHYAGKVSYDMDGFCERNRDVLF
MDLIELMQSSELPFIKSLFPENLQADKKGRPTTAGSKIKKQANDLVSTLMKCTPHYIRCI
KPNETKKPKDWEESRVKHQVEYLGLKENIRVRRAGYAYRRIFKKFLQRYAILTKATWPSW
RGDEKQGVLHLLQSVNMDSDQFQLGRSKVFIKAPESLFLLEEMRERKYDGYARVIQKSWR
KFAARKKYVQMREEASDLLLNKKERRRNSINRNFIGDYIGMEEHPELQQFVGKREKIDFA
DTVTKYDRRFKGIKRDLILTPKCLYLIGREKVKQGPDKGQVKEVLKRRIEMERILSVSLS
TMQDDIFILHEQEYDSLLESVFKTEFLSLLAKRYEEKTQKQLPLKFSNTLELKLKKENWG
PWSAGGSRQVQFHQGFGDLAILKPSNKVLQVSIGPGLPKNSRPTRRNTTQSRGYSSQTHN
ANYPMRAAPPPPGYHQNGVIKNQFVPHPHAPGNQRSNQKSLYTSMARPPLPRQQSTGSDR
TSQMPESLDFLKVPDQGVAGVRRQTTSRPNPAGGRPKPQPKPKPQVPQCKALYAYDAQDT
DELSFNANDIIDIIKEDVFSWPLDIVLGFTGIGPNCLVEKI
Download sequence
Identical sequences G1PN09
ENSMLUP00000012305 ENSMLUP00000012305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]