SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012336 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012336
Domain Number 1 Region: 317-626
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.22e-121
Family Mammalian PLC 0.000000276
Further Details:      
 
Domain Number 2 Region: 157-316
Classification Level Classification E-value
Superfamily EF-hand 2.28e-42
Family EF-hand modules in multidomain proteins 0.01
Further Details:      
 
Domain Number 3 Region: 646-771
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-30
Family PLC-like (P variant) 0.00031
Further Details:      
 
Domain Number 4 Region: 28-141
Classification Level Classification E-value
Superfamily PH domain-like 2.51e-29
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012336   Gene: ENSMLUG00000013543   Transcript: ENSMLUT00000013555
Sequence length 1018
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429775:2275268:2339718:-1 gene:ENSMLUG00000013543 transcript:ENSMLUT00000013555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGTKQKRERKKTVSFSSMPTEKKISSASDCINSMVEGSELKKVRSNSRIYHRYFLLDADM
QSLRWEPSKKDSEKAKIDIKSIKEVRTGKNTDIFRSNGISDQISEDCAFSVIYGENYESL
DLVANSADVANIWVTGLRYLISYGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITL
CNAVQCIRNLNPGLKTSKIELKFKELHKSKDTAGTEVTREEFVEVFHELCTRPEIYFLLV
QFSSNKEFLDTKDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYL
MSPDCYIFDPEHKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRS
VELDVWDGPDNEPVIYTGHTMTSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQK
VMVQHMKKILGDKLYTTSPNVEETYLPSPDVLKGKILIKAKKLSSSCSGMEGDVTDEDEG
AEMSQRMGKENAEQPNSVPAKRFQLCKELSELVSICKSVQFKEFQVSFQVQKYWEVCSFN
EVLASKYANENPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNFQTPGL
MMDLNIGWFSQNGNCGYVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKP
KGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDTPIFDESFEFQINLPELAMVRF
VVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKP
HKRGLSVRKGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCG
LSSVANLMQCMVAVSPRFLGPDNTPLVVLNLNEQYPTMELQGIVPEVLKKIVTTYDTMMQ
SLKALLENADAVYEKIVHCQKAAMEFHEHLHSIGTREGLKERKLQKAVESFTWNITILKG
QADLLKYAKNETLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEKASDEPGE
Download sequence
Identical sequences G1PN37
ENSMLUP00000012336 ENSMLUP00000012336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]