SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012398 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012398
Domain Number 1 Region: 390-593
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.67e-54
Family Nucleotide and nucleoside kinases 0.0000157
Further Details:      
 
Domain Number 2 Region: 248-380
Classification Level Classification E-value
Superfamily SH3-domain 9.84e-33
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 3 Region: 162-265
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-16
Family PDZ domain 0.001
Further Details:      
 
Domain Number 4 Region: 110-163
Classification Level Classification E-value
Superfamily L27 domain 0.000000000000194
Family L27 domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012398   Gene: ENSMLUG00000013620   Transcript: ENSMLUT00000013624
Sequence length 597
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429867:516353:532556:1 gene:ENSMLUG00000013620 transcript:ENSMLUT00000013624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKWGSQPHLGKGRRGEGEPREALGRYDVISIRQTERHFGTFADLTMPVAATNSETAMQQV
LDNLGSLPNATGAAELDLIFLRGIMESPIVRSLAKAHERLEETKLEAVRDNNLELVQEIL
RDLAQLAEQSSTAAELARILQEPHFQSLLETHDSVASKTYETPPPSPGLDPTFSNQPVPP
DAVRMVGIRKTAGEHLGVTFRVEGGELVIARILHGGMVAQQGLLHVGDIIKEVNGQPVGS
DPRALQELLRSASGSVILKILPSYQEPHLPRQVFVKCHFDYDPARDSLIPCKEAGLRFNA
GDLLQIVNQDDANWWQACHVEGGSAGLIPSQLLEEKRKAFVKRDLELTPNSGTLCGSLSG
KKKKRMMYLTTKNAEFDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLIMWDP
DRYGTTVPYTSRRPKDSEREGQGYSFVSRAEMEADIRAGRYLEHGEYEGNLYGTRIDSIR
GVVAAGKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDYETLRAMNRAALESGVSTKQLTE
ADLRRTVEESSRIQRGYGHYFDLSLVNCNLERTFRELQAAMEKLRTEPQWVPVSWVY
Download sequence
Identical sequences G1PN87
ENSMLUP00000012398 ENSMLUP00000012398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]