SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012406 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012406
Domain Number 1 Region: 182-446
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.06e-77
Family Protein kinases, catalytic subunit 0.000000000318
Further Details:      
 
Domain Number 2 Region: 77-213
Classification Level Classification E-value
Superfamily SH2 domain 9.69e-35
Family SH2 domain 0.00000174
Further Details:      
 
Domain Number 3 Region: 13-99
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-17
Family SH3-domain 0.0000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012406   Gene: ENSMLUG00000013625   Transcript: ENSMLUT00000013632
Sequence length 450
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429808:5884511:5889141:1 gene:ENSMLUG00000013625 transcript:ENSMLUT00000013632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKVGTKLSLMPWFHGKITREQAERLLCPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFFRSGWALNMKDLKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWQLDAATRPSFLQLREQLEHIKTHELHL
Download sequence
Identical sequences G1PN95
XP_005882831.1.60319 XP_006087939.1.53796 XP_006753780.1.95426 ENSMLUP00000012406 ENSMLUP00000012406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]