SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012424 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012424
Domain Number 1 Region: 1497-1808
Classification Level Classification E-value
Superfamily BEACH domain 1.96e-111
Family BEACH domain 0.000000129
Further Details:      
 
Domain Number 2 Region: 1924-2173
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.81e-35
Family WD40-repeat 0.0083
Further Details:      
 
Domain Number 3 Region: 1398-1501
Classification Level Classification E-value
Superfamily PH domain-like 3.32e-20
Family PreBEACH PH-like domain 0.02
Further Details:      
 
Domain Number 4 Region: 213-346,703-777,859-898,1083-1147
Classification Level Classification E-value
Superfamily ARM repeat 0.0000173
Family Leucine-rich repeat variant 0.082
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000012424
Domain Number - Region: 717-751,828-844,884-961,1029-1096,1161-1208,1264-1283
Classification Level Classification E-value
Superfamily ARM repeat 0.099
Family MIF4G domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012424   Gene: ENSMLUG00000013613   Transcript: ENSMLUT00000013650
Sequence length 2187
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430345:1:43525:1 gene:ENSMLUG00000013613 transcript:ENSMLUT00000013650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISMWVSGQRKPDVTLDFMLPRKTSLSSDSNKTFCMIGHSLSSQEEFLPLAGKWHLGNLLL
FNGAKVGSQEAFYLYACGPSHTSIMPCKHGTPASDYSKYINKDILQCDQIRELFMTKKDV
DIGLLIESLSVVYTSSCPAQYTIYEPVIRLKGQARAPLSQRPFSSKDVQSVSLEPHQLRS
LRPAHCETLQGVLHEIGGTGIFVFLFARVVELSSCEETQALALRVILSLIRYNQQRIQEL
ENCHGLSMIHQVLIKPKCTVGFHILKTLLEGCCGEEILYVDENGEFTLDVESKALIQDVK
LLEELLLDWKVWRKAEPGVWEALLAALEVLIRADHPQQMFNVKQLLRARAVHHFLLTCQV
LQEHKEGQLTSMPREVCRSFVKIIAEVLGSPPDLELLTIIFNFLLAVHPPTNTYICHNPT
NFYFSLHIDGKIFQEKVDSIVSLRHSSSGGRAGPRPGLMLISPSGFTASPPEGHSSSGSI
PPRTGASLRRSRSLPVLPTSSLVPPRTLAGGSDGGLNRVPSAAGSPVAPQPEQWNSPGSS
ETLKQGEEEASISSCESAEAVCEGDAGLPRPASVAGVPRGTPECPGVGVDQKELEAESRA
DGDGPGDASYPRRPDDLRGLASFQRSQSTVASLGLAFPSQSGSVPMRRWPSLVDRSAEDW
ASLAFSPGYEPNYLRTAHTPRVTEDALVPICCGLYELLSGVLLILPDAMLEDVMDKLIQA
EVLLVLVNHPSPAIQRGVIQLLDVYFNRASKEQKDKFLKNRGFSLLANQLYLHRATPELL
DCFVEMFFGRHIGPDDEFDQEDVRNLGLFQKWAVIPVLGLIETSLYDNTLLHNALLLLLQ
ILNSCSKVADMLLDNGLLYVLCNTVAALNGLEKNIPLNEYKLLACDIQQLLVAVTIHACS
SSGPQYFRVIEDLIVLLGYLQNSKNKRTQSMAVALQFRVLRAAMEFIRTTANHDSDSFTE
CFQAPSPQHAVFPKRKSIAGPWKCPLAHTDPFLMRMRSVASDELHVMIQRRMSQESPVQA
SEAELVQRLQRLIVLAVNRLIYQEFNPDVVAILSTPENATQSKTSASQTEISEENSHREQ
ISVFNPFQKEILTYLIEGFKVSVGSSKPSGSKQQWAKIVWSCKDTFRMQLGRLLAHILSP
AHPSQERKQIFEIVQEPNHQEILRDCLSPSLQHGAKLVLYLSELIHNHPEELTWEELDAA
QLLMSALQACGHRGPPPSAAAKPELLRVIREEQKKYETEEGVNKATWQKTVKNNQQSLFQ
RLDSKSKEISKTAADITQAVSLSQGIERKKVIQHIRGMYKVDLSASRHWQELSQQLTHDR
AVWYDPTYYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYLLRDRQRPEGVVRPPLSYLFE
DKTHSSFSSTVKDKAASESIRVNRRCISVAPSRETAGELLLGKCGMYFVEDNASDTVESS
SPQGELEPASFSWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLALDSTKVRDDVYHSI
LTNDLPNLLEYGNITALTNLWYTGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILADYV
SETLDLGDPSVYRNLSKPIAVQYKEKEDRYVDTYKYLEEEFRKGAREDDPLPPVQPYHYG
SHYSNSGTVLHFLVRMPPFTRMFLAYQDQSFDIPDRTFHSMNTTWRLSSFESMTDVKELV
PEFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDHVSQNI
CQWVDLVFGYKQKGKASVHAINVFHPATYFGMDVSAVEDPVQRRALETMIKTYGQTPRQL
FQAAHVSRPGPRLSLEGELPAAVGLLVQFAFRETREPVREAPHPSPLSWIKGLKWGEYVG
SPSAPVPVVCFSQPHGERLGSLQALPTRAICGLSQNFCLLVTYSKEQGVRSMNSTDIQWS
AILSWGYADNILRLKSKQSEPPVNFIQSSQQHQVTSCAWVPDSCQLFTGSRCGVITAYAN
RMAGSAPSEIEMESQVHLYGHTEEVTSLFVCKPYSILISVSRDGTCVIWDLNRLCYVQTL
AGHKSPVTAVSASETTGDIATVCDSAGGGSDLRLWTVNGDLVGHVHCREVICSVAFSNQP
EGVSINVIAGGLENGTVRLWSTWDLKPVREITFPKSNKPIVSLTFSCDGHHLYTANSEGT
VIAWCRKDQQRLKQPMFCSFLSSYAAG
Download sequence
Identical sequences G1PNB3
ENSMLUP00000012424 ENSMLUP00000012424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]