SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012475 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012475
Domain Number 1 Region: 79-183
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-25
Family PDZ domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012475   Gene: ENSMLUG00000013703   Transcript: ENSMLUT00000013705
Sequence length 467
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430148:822715:837356:-1 gene:ENSMLUG00000013703 transcript:ENSMLUT00000013705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHGFSVGFDPLGLGDLSSGSLSSLSSRGHLGSDTGSATRYLLRKQQRLLNGPSRGIRAS
SPMGRVILINSPIEANSDESDIIHAVRVEKSPAGRLGFSVRGGSEHGLGIFVSKVEEGSS
AERAGLCVGDKITEVNGLSLESTTMGSAVKVLTGSSRLHMMVRRMGRVPGIKFSKEKTTW
RLAGTLPTRRWFLSTVGWTDPLQPPGCSLVSAEEKKQRKKEKSGSSGEKGALQRSKTLMN
LFFKGGRQGRLGDGRREAWTLERGSPAKPRPRLDVEKAGGAGPVQKFVTWRLRRDRERGR
ALLSARSGSPSSQLPNVDEQVQAWESRRPLIQDLARRLLTDDEVLAVTRHCSRYVHEGGV
EDLVRPLLAILDKPAKLLLLRDIRSVVAPTDLGRFDSMVMPVELEAFEALKSRAVRPPAL
RPARQDTPPKRHLITPVPGQSESQGRGRGTPRGTGEGGQAFFWPRPR
Download sequence
Identical sequences G1PNG0
ENSMLUP00000012475 ENSMLUP00000012475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]