SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012578 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012578
Domain Number 1 Region: 226-420
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.9e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.00000000528
Further Details:      
 
Domain Number 2 Region: 10-112
Classification Level Classification E-value
Superfamily SH2 domain 1.31e-24
Family SH2 domain 0.00000105
Further Details:      
 
Domain Number 3 Region: 156-220
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.88e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012578   Gene: ENSMLUG00000013813   Transcript: ENSMLUT00000013824
Sequence length 420
Comment pep:novel scaffold:Myoluc2.0:GL429819:1977073:2041632:-1 gene:ENSMLUG00000013813 transcript:ENSMLUT00000013824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VENRPKYYGREFHGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLF
YDGKHFVGEKRFESIHDLVTDGLITLYIETKASEYISKMTTNPIYEHIGYATLLREKVSR
RLSRSKNEARKASVTSEEHPTVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWC
EYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNA
QRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKVDISANLYPDINII
TGALKLYFRDLPIPVITYDTYSKFIEAAKISNADERLEAVHEVLMLLPPAHYETLRYLMI
HLKKVTMNEKDNFMNAENLGIVFGPTLMRPPEDSMLTTLHDMRYQKLIVQILIENEDVLF
Download sequence
Identical sequences G1PNP5
ENSMLUP00000012578 ENSMLUP00000012578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]