SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012595 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012595
Domain Number 1 Region: 11-136
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-29
Family SH2 domain 0.000000143
Further Details:      
 
Domain Number 2 Region: 158-257
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-26
Family SH2 domain 0.00000181
Further Details:      
 
Domain Number 3 Region: 361-444
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.67e-19
Family Protein kinases, catalytic subunit 0.00000955
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012595   Gene: ENSMLUG00000013839   Transcript: ENSMLUT00000013843
Sequence length 444
Comment pep:known_by_projection scaffold:Myoluc2.0:GL432377:270:10343:-1 gene:ENSMLUG00000013839 transcript:ENSMLUT00000013843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAAMPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRF
HHFSIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFD
CLRDAMVRDYVRQTWKLEGEALEQAILSQAPQVEKLIATTAHEMPWYHSNLTREEERKLY
ASSQTDGKFLLRPRKEQGTYALSMIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEY
LKLKADGLIYCLKEACPNASASASAASETDRHPQTWLPGAYGDAGGHRRSAPTDGTRSAH
MCTHTRTHAPVHALGGTPLSTKPRPLPMDTSVYESPYSDPEELKDKKLFLKRDNLLVADI
ELGCGNFGSVRQGVYRMRKKQIDVAIKVLKHSTEKADKDEMMREAQIMHQLDNPYIVRLI
GVCQAEALMLIMEMAGGGPLHKFL
Download sequence
Identical sequences G1PNQ8
ENSMLUP00000012595 ENSMLUP00000012595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]