SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012669 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012669
Domain Number 1 Region: 396-497
Classification Level Classification E-value
Superfamily E set domains 1.07e-25
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 185-243
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000071
Family B-box zinc-binding domain 0.003
Further Details:      
 
Domain Number 3 Region: 26-59,93-101
Classification Level Classification E-value
Superfamily RING/U-box 0.000001
Family RING finger domain, C3HC4 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000012669
Domain Number - Region: 237-327
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000432
Family Apolipoprotein A-I 0.016
Further Details:      
 
Domain Number - Region: 76-139
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0871
Family Recombination endonuclease VII, N-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012669   Gene: ENSMLUG00000013923   Transcript: ENSMLUT00000013925
Sequence length 579
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429970:1860136:1867473:1 gene:ENSMLUG00000013923 transcript:ENSMLUT00000013925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKRKPLLGFMGKLPSGPALGNSSKTHCPSCMGLFQAPRLLPCLHTVCTTCLEQLEPFS
VVDIRGGDADTSSEGSLFQELKPALRPQTGILCPVCDAQVDLPVGGVKALTIDHLAMNDV
MLESLCGEGQGLVCDLCSDRDVEKRCQTCKANLCHFCCQAHRRQKKTTYHTMVDLKDLKG
YSRVGKAILCPAHPAEELRLFCELCDQPVCRDCVVGAHREHPCDFTSNVIHKHGDSVREL
LKNTQPRVEALEEALAQVKETNGALQQRVEAVAADIRTFSEGYIKAIEEHRDKLLKQLED
IRAQQENSLQLQKAQLEQLLADMRTGVEFTEHLLTSGSDLEILITKGVVVERLTKLNQVE
YSARPRVNDKICFSPQEKAGRCRGYEVYGAINTKEVDPAKCVLQGKDLHRAREKQTASFT
LLCKDAAGESMGRGGDNIQVAVVPKDKKDSPVRTMVQDNKDGTYGVSYTPKEPGIYKVLV
CVKEQHVQGSPFTVTVRKRHHSHQGVFHCCTFCSSGGQKTARCACGGTMPGGYLGCGHGH
KGHPGRPHWSCCGKFTEKSECTWTGGQSTARSLLRTVAL
Download sequence
Identical sequences G1PNX1
ENSMLUP00000012669 ENSMLUP00000012669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]