SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012676 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012676
Domain Number 1 Region: 14-125
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000421
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012676   Gene: ENSMLUG00000013930   Transcript: ENSMLUT00000013932
Sequence length 446
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429805:7293626:7352453:1 gene:ENSMLUG00000013930 transcript:ENSMLUT00000013932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVDETHFLDFINSYARVRAVVMTRDDSSGGWLPLGGSGLSCVTVCRASHQEEDGCSDFLI
RGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIEDKKFGLTFQSPADARAFDRGIRRAI
EDISQGCPALKNETEGADDDLQATAEENIPSSRVKDHLFQQETVVTSEPYRSSRPSPFED
LNARRVYLQSQASQITFTHPSLDIQGRSIEYAQRQISKECGGLKSQNKYPVLCLVPRHVS
FQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDTDSNIQFSKPDSKKSDYLYSCGD
ETKLSSFKDSVVFKTQPSSLKFKKSKRRKEDGERSRCVYCQERFNHEENGRGKCQDAPDP
IKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMC
CYVPLRMCHRCGEACGCCGGKHKAAG
Download sequence
Identical sequences G1PNX7
ENSMLUP00000012676 ENSMLUP00000012676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]