SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012677 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012677
Domain Number 1 Region: 153-262,308-579
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.26e-149
Family Myotubularin-like phosphatases 0.0000000272
Further Details:      
 
Domain Number 2 Region: 1118-1194
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.76e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 52-132
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000908
Family GRAM domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012677   Gene: ENSMLUG00000013929   Transcript: ENSMLUT00000013933
Sequence length 1201
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430036:121557:160578:-1 gene:ENSMLUG00000013929 transcript:ENSMLUT00000013933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDEETRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEYVGRAEDAIIALSNYRL
HIKFKESLVNVPLQLIESVECRDIFQLHLTCKDCKVIRCQFSTFEQCQEWLKRLNNAIRP
PAKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKNEVERMGFDMINAWRISN
INEKYKLCGSYPQELIVPAWITDKELESVAGFRSWKRIPAVIYRHQSNGAVIARCGQPEV
SWWGWRNADDEHLVQSVAKACASNSRSSGSKLSTRNSSRDFPNAGDLSDVEFDSSLSHAS
GAESLAIQPQKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMANIHSIRRSFQ
SLRLLCTQMPDPGNWLSALESTKWLHHLSVLLKSALLVVHAVDRDQRPVLVHCSDGWDRT
PQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFADRCGHGENSDDLNERCPVFLQWL
DCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFLCNNAKERGEKHTQERTCSVWSLL
RAGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVYLPCPSPSTPVDDSCAPYPAPGNSP
DDPLLSRLPKTRSFDNLTTACDNTVPLASRRSSDPSLNEKWQEHQHRRSLELSSLAGPGE
EPLDPDSLGKPTKVLGGAELSVAAGVAEGQMENILQEATKEESGAEETVQRGSVLMQEGT
EEALVEKESRGKAPEDSAIVLHQAPPLDPAVLRSPPGISLPLSSQGLPDQQGGHSVLPSS
LQEPPMGEEVLEVPVEQPQIGDIAEEREEAMTTIPVDEKIGYGTSQSSPPLLSQVPFEGR
GPNIDSSLDMLMEDKVKSESGPPHRPCLVNSGRLSGKDVLQAVEPRPPEKSLAERPQAGS
VVQRTSPGSTHSPARSPCALPVAECKEGLVCNGVPETENKASEQPPGLSTLQEYPTPNGH
CANGEAGRSKDSLSCQLSAISCSSAHLHSRNLHHKWLHSQTGRPSATGSPDQPSRSHLDD
DGMPVYTDTIQQRLRQIESGHQQEVETLKKQVQELRSRLESQYLTSSLRFNGDFGDEVTS
IPDSESNLDQNSLSRCSTEIFSEASWEQVDKQDTEMTRWLPDHLAAHCYACDSAFWLASR
KHHCRNCGNVFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHPTSSSIDLELDKPIAATS
N
Download sequence
Identical sequences G1PNX8
ENSMLUP00000012677 ENSMLUP00000012677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]