SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012742 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012742
Domain Number 1 Region: 10-131
Classification Level Classification E-value
Superfamily PH domain-like 4.67e-38
Family Phosphotyrosine-binding domain (PTB) 0.00000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012742   Gene: ENSMLUG00000014002   Transcript: ENSMLUT00000014006
Sequence length 494
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430948:21096:29260:-1 gene:ENSMLUG00000014002 transcript:ENSMLUT00000014006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCCSCLNRDGIPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIIT
RNSHPAELDLPRAPLPTRALGYSVSSFSNGFPGCPGEGPRFSAPRRPSTSSLRHPSLGEE
STHALIAPDEQSHTYVNTPASEDDHRRSRHCLQPLPEGRAPFPPRAPGPDQRDPQVFWQP
GQVKFVLGPTPARRHMMKCQGVCPSLRDAAHHNNNEGPSECPAQPKCTYENVSGGLRPGA
SWRLSPEEPGWNGLAHRRAALLHYENLPSLPPVWESHAQQLGEEAGDDGDSRDGLTPSSN
GFPDGEEDETPLQKPTSTRAALRSHSSFPVPLTRCRGSPRVFNFDFRRPGPEPPRQLNYI
QVELKGWGGDHPKGPQNPTTPQTPLPTTHPARSSDSYAVIDLKKTVAMSNLQRALPWDDG
TARKTRHNSTDLPL
Download sequence
Identical sequences G1PP32
ENSMLUP00000012742 ENSMLUP00000012742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]