SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012783 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012783
Domain Number 1 Region: 73-413
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-87
Family Protein kinases, catalytic subunit 0.00000221
Further Details:      
 
Domain Number 2 Region: 950-1015
Classification Level Classification E-value
Superfamily G protein-binding domain 3.14e-21
Family RhoA-binding domain 0.0000572
Further Details:      
 
Domain Number 3 Region: 1119-1209,1291-1322
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000721
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 4 Region: 1228-1277
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000112
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Domain Number 5 Region: 427-530
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000497
Family Myosin rod fragments 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012783   Gene: ENSMLUG00000014044   Transcript: ENSMLUT00000014055
Sequence length 1356
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429967:110099:236979:-1 gene:ENSMLUG00000014044 transcript:ENSMLUT00000014055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLTSANPNDNRTSSNV
DKSLLKQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKIDKIMKELDEEGNQRRNLE
STVSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANE
KLAQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSVSQLESLNRELQERNRILENSKSQ
TDKEYYQLQTALEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHTLERVEEERKEAQDM
LNHSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMYEMEK
KLKEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLAESKERMEDEVKNLTLQLEQ
ESNKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQ
MRELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETK
AESEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEMNSMLAKDVELLRKE
NEELTDKMRKSEEDYKLKKEEEISNLKAAFEKNISTERTLKTQAVNKLAEIMNRKDFKID
RKKANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQM
QLASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGW
KKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQI
LYANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPA
LECRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPK
NPPSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTR
Download sequence
Identical sequences G1PP69
ENSMLUP00000012783 ENSMLUP00000012783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]