SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012808 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012808
Domain Number 1 Region: 524-704
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.26e-50
Family SPRY domain 0.00085
Further Details:      
 
Domain Number 2 Region: 181-246
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.83e-17
Family B-box zinc-binding domain 0.0000332
Further Details:      
 
Domain Number 3 Region: 17-104
Classification Level Classification E-value
Superfamily RING/U-box 8.08e-16
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 4 Region: 388-439,481-529
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000023
Family Fibronectin type III 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000012808
Domain Number - Region: 125-177
Classification Level Classification E-value
Superfamily RING/U-box 0.000865
Family ZZ domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012808   Gene: ENSMLUG00000014079   Transcript: ENSMLUT00000014082
Sequence length 711
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430318:9595:114748:-1 gene:ENSMLUG00000014079 transcript:ENSMLUT00000014082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SASVEFADAPGELRLKMETLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCAT
NESVESITAFQCPTCRHVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRER
AFDANAMTSAEKVLCQFCDQEPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEP
IPDSHIRGLMCLEHEDEKVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKQNLE
SNLTNLIKRNTELETLLAKLIQTCQHVEVNASRQEAKLMEECDLLIEIIQQRRQIIGTKI
KEGKVMRLRKLAQQIANCKQCIERSASLISQAEHSLKENDHARFLQTAKNITERVSMATA
SSQVLIPEINLNDTFDTFALDFSREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWT
SDDEFSVVSYELQYTIFTGQANVVKRLLCHWGPKDEIRKMKEAVALSRTIEFITGLCNSA
DSWMIVPNIKQNHYTVHGLQSGTKYIFIVKAINQAGSRSSEPGKLKTNSQPFKLDPKSAH
RKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGRHYWEVVISGSTWYA
IGLAYKSAPKHEWIGKNSASWALCRCHNNWVVRHNSKEIPIEPSPHLRRVGILLDYDNGS
VAFYDALNSVHLYTFDITFSQPVCPTFTVWNKCLTIITGLPIPDHLDCTEQ
Download sequence
Identical sequences G1PP87
ENSMLUP00000012808 ENSMLUP00000012808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]