SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012859 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012859
Domain Number 1 Region: 165-293
Classification Level Classification E-value
Superfamily PH domain-like 2.44e-24
Family Pleckstrin-homology domain (PH domain) 0.000000909
Further Details:      
 
Domain Number 2 Region: 847-916,985-1059,1130-1170,1293-1312,1416-1558
Classification Level Classification E-value
Superfamily ARM repeat 0.000000012
Family Mo25 protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012859   Gene: ENSMLUG00000014111   Transcript: ENSMLUT00000014136
Sequence length 2093
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430087:611748:745542:-1 gene:ENSMLUG00000014111 transcript:ENSMLUT00000014136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLTSPLVPCKWESLKLGRGLTSPGVTQDMTGSSTRIHRLRFQAKPKLIEPLDYENVIVQK
KTQILNDCLREMLLFPYDDFQTAILRRQGRYRCSTVPAHAQEEAQSLFVTECIKTYNSDW
HLVNYKYEDYSGEFRQLPNKGAKLDKLPVHVYEVDEEVDKDEDAASLGSQKGGITKHGWL
YKGNMNSAISVTMRSFKRRFFHLIQLGDGSYNLNFYKDEKISKEPKGSIFLDSCMGVVQN
NKVRRFAFELKMQDKSSYLLAADSEVEMEEWITILNKILQLNFEAAMQERRNGDSHEDDE
QSKLEGSGSGLDSYLPELVKSTREAEIKLKSESRVKLFYLDPDAQKLDLPSAEPEVKPFE
EKFGKRILVKCNDLSFNLQCCVAENEEGPTTNVEPFFVTLSLFDIKCNRKISADFHVDLN
HFSVRQMLATPSSALMNGSGQSSPTLPDILHEAAMQYPKQGIFSVTCPHPDIFLVARIEK
VLQGSITHGAEPYMKSSDSSKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFRDTSGNLD
KNARFSALYKQDSNKLSNDDMLKFLADFRKPEKMAKLPVILGNLDITIDNVSSDFPNYVN
SSYIPTKQFETCTKTPIMFEVEEFVPCLAKYTQPYTTYNNHLYVYPKYLKYDSQKSFAKA
RNIAICIEFKDSDEEDSQPLKCIYGRPGGPVFTRSAFAAVLHHHQNPEFYDEVKIELPTQ
LHEKHHLLFTFFHVSCDNSNKGSTKKKDVVETQVGYSWLPLLKDGRVVTNEQHVPVSANL
PSGYLGYQELGMGRHCGPEIKWVDGSKPLLKVSTHLVSTVYTQDQHLHNFFQYCQKTESG
AQALGNELVKYLKSLHAMEGHVMIAFLPTILNQLFRVLTRATHEEVAVNVTRVIIHVVAQ
CHEEELESHLRSYVKYAYKAEPYIAAEYKTVHEELAKSMTAILKPSADFLTSNKLLKYSW
FFFDVLIKSMAQHLIENSKVKVLRNQRFPASYHHAVETVVNMLMPHITQKFRDNPEASKN
ANHSLAVFIKRCFTFMDRGFVFKQINNYTSCFAPGDPKTLFEYKFEFLRVVCNHEHYIPL
NLPMPFGKGRIQRYQDLQLDYSLTDEFCRNHFLVGLLLREVGTALQEFREVRLIAISVLK
NLLIKHSFDDRYASRSHQARIATLYLPLFGLLIENVQRINVREVSPFPVNPGSTAKEETL
TLPAVNPLVTPQKSGNTLDNSLHKDLFGAISGIASPYTTSTPNINSVKNADSRGSLISTD
SGNSFLERNIEKSNSLDKHQQSGTLGNAMVRCDKLDQSEIKSLLMCFLYILKSMSDDALF
TYWNKASTSELMDFFTISEVCLHQFQYMGKRYIARNQEGLGPIVHDRKSQTLPVSHNRTG
MMHARLQQLGSLDNSLTFNHSYGHSDADVLHQSLLEANIATEVCLTTLDTLSLFTLAFKN
QLLADHGHNPLMKKVFDVYLCFLQKHQSETALKNVFTALRSLIYKFPSTFYEGRADMCAA
LCYEILKFCNSKLSSIRTEASQLLYFLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVG
IGGTRFQQSLSIINNCANSDRLIKHTTFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLV
DLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGMFRQ
GCTAFRVITPNIEEEASMMEDVGMQDVHFNEDVLMELLEQCADGLWKAERYELIADIYKL
IIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKE
YIYKEPKLTPLSEISQRLLKLYSDKFGSENVRMIQDSGKVNPKDLDSKYAYIQVTHVTPF
FDEKELQERKTEFERSHNIRRFMFEMPFTQAGKRQGGVEEQCKRRTILTAIHCFPYVKKR
IPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSADVDMIKLQLKLQGSVSVQVNAGPLA
YARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALVVNERLIKEDQLEYQEEMKANYR
EMAKELSEIMHEQICPLEEKTSVLPNSLHIFNAISGTPTSTMVHGMTSSSSVL
Download sequence
Identical sequences G1PPD2
ENSMLUP00000012859 ENSMLUP00000012859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]