SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012868 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012868
Domain Number 1 Region: 407-731
Classification Level Classification E-value
Superfamily DNase I-like 5.89e-58
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0001
Further Details:      
 
Domain Number 2 Region: 20-119
Classification Level Classification E-value
Superfamily SH2 domain 1.06e-26
Family SH2 domain 0.00016
Further Details:      
 
Domain Number 3 Region: 1201-1263
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000359
Family SAM (sterile alpha motif) domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012868   Gene: ENSMLUG00000014132   Transcript: ENSMLUT00000014146
Sequence length 1265
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429905:915474:928597:-1 gene:ENSMLUG00000014132 transcript:ENSMLUT00000014146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKRLHRSTGPGGALGSPAPAWYHRDLSRAAAEELLARAGRDGSFLVRDSESVAGAFALCV
LYQKHVHTYRILPDGEDFLAVQTSQGVPVRRFQTLGELIGLYAQPNQGLVCALLLPVERE
REPDPQDDRDASDGEDEKPPLPPRSGSTSICASVGPSSPPPAPETPTTPAAESAPNGLST
VSHEYLKGSYGLDLEAVRSGASNLPHLTRTLATSCRRLHSEVDKVLSGLEILSKVFDQQS
SPMVTRLLQQQNPPQTGEQELESLVLKLSVLKDFLSGIQKKALKALQDISSTAPPAPLQP
CTRKAKTIPVQAFEVKLDVTLGDLTKIGKSQKFTLSVDVEGGRLVLLRRQRDSQEDWTTF
THDRIRQLIKSQRVQNKLGVVFEKEKDRTQRKDFIFVSARKREAFCQLLQLMKNKHSKQD
EPDMISVFIGTWNMGSVPPPKNVTSWFTSKGLGKTLDEVTVAIPHDIYVFGTQENSVCDR
EWLDLLRGGLKELTDLDYRPIAMQSLWNIKVAVLVKPEHENRISHVSTSSVKTGIANTLG
NKGAVGVSFMFNGTSFGFVNCHLTSGNEKTARRNQNYLDILRLLSLGDRQLSAFDISLRF
THLFWFGDLNYRLDMDIQEILNYISRKEFEPLLRVDQLNLEREKHKIFLRFSEEEISFPP
TYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPETHIICNSYGCTDDIVTSDHS
PVFGTFEVGVTSQFISKKGLSKTSDQAYIEFESIEAIVKTASRTKFFIEFYSTCLEEYKK
SFENDAQSSDNINFLKVQWSSRQLPTLKPILADIEYLQDQHLLLTVKSMDGYESYGECVV
ALKSMIGSTAQQFLTFLSHRGEETGNIRGSMKVRVPTERLGTRERLYEWISIDKDEAGTK
GKAPSVSRGSQEPRSGSRKPAPTEAFCPLSKLFEEPEKPPPTGRPPAPPRATPREEPLTP
RLKPEGAPEPEGVAAPPPKNSFNNPAYYVLEGVPHQLLPPEPPPPARALVPPAAKNKVAI
TVPAPQLGRHRPPRVGEGSSSDEEPGGTLPPPDFPPPPLPDSAIFLPPSLDPLPGPVVRG
RSGGEARGPPPPKAHPRPPLPPGPSPTSTFLGEVASGDDRSCSVLQMAKTLSEVDYAPAG
PGRSVLLPGPLELQPPRGLPTDYGRPLSFPPPRIRESIQEDLAEEAPCPCPCPCPQSGRA
GGLGEAGMGAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDT
LQLSK
Download sequence
Identical sequences G1PPE0
ENSMLUP00000012868 ENSMLUP00000012868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]