SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012893 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012893
Domain Number 1 Region: 493-595
Classification Level Classification E-value
Superfamily PDZ domain-like 7.36e-24
Family PDZ domain 0.0000282
Further Details:      
 
Domain Number 2 Region: 982-1052
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.29e-17
Family SAM (sterile alpha motif) domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012893   Gene: ENSMLUG00000014166   Transcript: ENSMLUT00000014173
Sequence length 1094
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429782:3635747:3866397:1 gene:ENSMLUG00000014166 transcript:ENSMLUT00000014173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKTESSGERTTLRSASPHRNAYRTEFQALKSTFDKPKSDGEQKTKEGEGSQQSRGRKYG
SNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGPSSPQRRMRPKEFLEKTDGSVVKLESSV
SERISRFDTMHDGPSYSKFTETRKLFERSVHESGQNNRYSPKKEKAGGNEPQDEWGGSKS
NRGSTDSLDSLSPRTEAVSPTVSQLSAVFENTDSPNSIIPEKAENEYSVTGHYPLNLPAV
TVTNLDTFSRLKDSDSCTPPSKHGDDAEDAQKSDTSPVPEVASKSTSLTLIPSEEAELSK
EAEDSTSNQETPDRVDKDVPGEPCAENKAMPESDILSPQSEPLEDAKANLVGNEAAMPQK
KELAGGDFISADASGSSCGKEVPEDSSNIESPHVYMHSDYNVYRVRSRYNPDWRETGTEQ
DEQEDSDENNYYQPDMEYSEIVGLPEEEEIPTNRKIKFSSAPIKVFSTYSNEDYDRRNDE
VDPVAASAEYELEKRVEKLELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVTE
GGAAQRDGRIQVNDQIVEVDGISLVGVTQNFAATVLRNTKGNVRFVIGREKPGQVSEVAQ
LISQTLEQERRQREMLEQHYAQYDADDDETGDYATDEEEDEEGPTLPGSDMAIEVFELPE
NEDMFSPSDLDTTKLSHKFKELQIKHAVTEAEIQKLKTKLQAAENEKVRWELEKTQLQQN
IEENKERMLKLESYWIEAQTLCHTVNEHLKETQSQYQALEKKYNKAKKLIKDFQQKELDF
IKRQEAERKKIEDLEKAHVVEVQGLQVRIRDLEVEVFRLLKQNGTQVNNNNNIFERRTSL
GEVSKGDTMENVDVKQMSCPDGLSQDLNEAVPETERLDSKALKTRAQLSVKNRRQRPSRT
RLYDSVSSTDGEDSLERKNFTFNDDFSPSSTSSADLSGLGAEPRTPGLSQSLALSSDESL
DMIDDEILDDGQSPKHSQCQNRAVQEWSVQQVSHWLMSLNLEQYVSEFSAQNITGEQLLQ
LDGNKLKALGMASSQDRAVVKKKLKEMKVSLEKARKAQEKMEKQREKLRRKEQEQMQRKS
RKTEKMAIEGAGEQ
Download sequence
Identical sequences G1PPG1
ENSMLUP00000012893 ENSMLUP00000012893 XP_006085044.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]