SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012903 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012903
Domain Number 1 Region: 191-217,258-503
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.52e-71
Family Nuclear receptor ligand-binding domain 0.00000000108
Further Details:      
 
Domain Number 2 Region: 139-218
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.83e-28
Family Nuclear receptor 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012903   Gene: ENSMLUG00000014181   Transcript: ENSMLUT00000014184
Sequence length 551
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430172:252236:455528:-1 gene:ENSMLUG00000014181 transcript:ENSMLUT00000014184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGKPAVYNYPEGAAYDFNAAAAASAPVYGQSGLAYGPGSEAAAAFGANGLGGYPPLNSVS
PSPLVLLHPPPQLSPFLHPHGQQVPYYLENEPSGYAVREAGPPAFYRPNSDNRRQGGRER
LASSGDKGSMAAESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPAT
NQCTIDKNRRKSCQACRLRKCYEVGMMKGGLRKDRRGGRMLKHKRQRDDGESRNDAGSSG
DMRAASLWPSPLLIKHTKKNSPALSLTADQMVSALMEAEPPIIYSEYDPSRPFSEASMMG
LLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLF
APNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSS
TLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEH
LYNMKCKNVVPLYDLLLEMLDAHRLHAPASRGAAPMEEPHQGQMATTGPTLPHSLPTYYI
SGEAEGFPNTV
Download sequence
Identical sequences G1PPH0
ENSMLUP00000012903 ENSMLUP00000012903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]