SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012922 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000012922
Domain Number - Region: 25-102
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00502
Family BAR domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012922   Gene: ENSMLUG00000014203   Transcript: ENSMLUT00000014207
Sequence length 781
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429884:885836:919861:1 gene:ENSMLUG00000014203 transcript:ENSMLUT00000014207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFVTEVLAHSGSLEKEDLGTRISHLTRRVEEIKGEVCSMISKKYSEFLPSMQSAQDLI
TQVDKLSDDIDLLKSRIESEVRRDLHVSTAEFTDLKQQLEKDSVVLSLLKQLQEFSTAIE
EYNSALAEKKYVTAALRLEEAQKCLKLLKSRKCFDLKMLKSLSMELTIQKQNILYHLGEE
WQKLIVWKFPPSKDTSNLESCLQTQLHLCTEQSQNEEKPPMPPTSSVLLAFSILGELHTK
LKSFGQMLLKYILRPLASCPSLFVVVESQPNIIIIRFESVMTDFEHPSPSEVFAKVKLVL
EVLQKHLLDLPLDTDLENEKTSKIILAEMLGDLIWEDLSECLIKNCLVYSIPTNSSKLQQ
YEEIIQSTEEFENALKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARNLMTSEIH
NTVKIIPDSKISVPDLPTSDEDDKLQIQKMSTTQYNEMVNLQPENTLDQHSFSLPTCRVS
ESVKKLMELAYQTLLEATTSSDQCAVQLFYSVRNIFHLFHDVVPTYHKENLQKLPQLAAI
HHNNCMYIAHHLLTLGHQFRLRLAPILCDGTTTFVDLVPGFRRLGTECFLAQMRAQKGEL
LERLSSARNFSNMDDEENYFAASKAIRQVLHQLKRLGIVWQDVLPVNIYCKAMGTLLNTA
ISEIIGRITALENQDISTEDGDRLYSLCKTVMDEGPQVFAPLSEESKNKKYQEEVPVYVP
KWMPFKELMMMLQASLQEIGDRWADGKGPLAAAFSSSEVKALIRALFQNTERRAAALAKI
K
Download sequence
Identical sequences G1PPI7
ENSMLUP00000012922 ENSMLUP00000012922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]