SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012970 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012970
Domain Number 1 Region: 10-171,206-221
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.19e-43
Family Ribonuclease PH domain 1-like 0.000000117
Further Details:      
 
Domain Number 2 Region: 192-283
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.07e-24
Family Ribonuclease PH domain 2-like 0.00000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012970   Gene: ENSMLUG00000014256   Transcript: ENSMLUT00000014259
Sequence length 291
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429962:2492362:2509023:-1 gene:ENSMLUG00000014256 transcript:ENSMLUT00000014259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLLVLFHPPKGWITNKYLEDLRVDGRGCEDYRCVEVETDVVSNTSGSARVKLGHTDILV
GVKAEMGTPKLEKPNEGYLEFFVDCSANATPEFEGRGGDELGTEIANTLYRIFSNKSSVD
LKSLCISPREHCWVLYVDVLLLECGGNLFDAISIAVQYKLIASRIPRVRVLEDEEGSKDI
ELSDDPYDCIRLSVENVPCIVTLCKIGCRHVVDATLQEEACSLASVLVSVTSQGVVTCMR
KVGKGSLDPESIFEMMETSKRVGKVLHTSLHSILHKEESLGPKRQKVGFLG
Download sequence
Identical sequences G1PPM4
ENSMLUP00000012970 ENSMLUP00000012970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]