SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012979 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012979
Domain Number 1 Region: 647-716
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000557
Family SH3-domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012979   Gene: ENSMLUG00000014264   Transcript: ENSMLUT00000014270
Sequence length 722
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429935:104869:164586:-1 gene:ENSMLUG00000014264 transcript:ENSMLUT00000014270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERLRNFKELQAKFQKLDVSSLPGPIKSLAGVSPKGDIGSTQSTIWANGKPFSSNHNQPPP
YCSNGEPQSLEPEKMKSAPRSDIQKCSNSLGPPGRSTHSAENSQKASLPLHVNQSNAKVT
DKKKEVASTFRDKLQNWEKVSSQKSDMSSALRLASCGSGALHPEDQKSTGLTTPEEPRKQ
LEIKGSQTLPSQRHLMAQRKSHVTSEDPTFLLSQHGKKSLEKANPERSPAGSTCQPIYES
ELASQAPEKDPDVKHHQLPKTKPLPSVESLGPPPVKPPKPPGVSLQAFLRRTAAVPKTPR
EAAVKEGYLPPESAEVEEPHNYEAIIPYLRHSGNSINLRTAKEIAGSTYEVGIEELQKPW
KSFLHQEHSPQDEDQDKKIKEKEPHELEPQKTEKDLHPDLMCKVRSCEETCGKVPVMKVQ
RHMKRMLAREHDAVIDSIQTEACPQDPKLARHSQGQCGYVEALEVTKEAPGQGAFRPQSI
SEETYDDVECPGRKESKSDFSNSFASDSEENSNEMYEDVYKTKSNSTNIDLDGKTLKRLQ
RFFKKEKDRFKMKTTKLKENVSSAFSISLPDLGKKLKLRSQEVIMHADVTINEKESKDED
KVKTWKPKFFKPKGEKEKKDAQGSESLSPRNFFRTKKQNLEKRMEREKLFRERFEYDKEI
TVINTAVACSRNSRNGIFDLPITPGEELDVIDVTEENLVICRNSKGKYGYVLIEHLDFKP
QG
Download sequence
Identical sequences G1PPN0
ENSMLUP00000012979 ENSMLUP00000012979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]