SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012996 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012996
Domain Number 1 Region: 1763-1850
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-23
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012996   Gene: ENSMLUG00000014283   Transcript: ENSMLUT00000014288
Sequence length 2324
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430180:252183:303991:1 gene:ENSMLUG00000014283 transcript:ENSMLUT00000014288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGEAGNASCAHCEANVLAQSCCQNCFHPEEAYRARHQEPGSPPGAEAPYCDLPRRPPAS
EDLHRASASGCQSAVGLGLGPESERRPVTGLPAEGPSATPRSRSWDSEAVPYLEGPASSL
CSFDEGPDSGTSSSPDCDAPDDTSNSSSVDWDVVKRQEEAPGGDEITEMIPRKLQEGSRA
DSTHRAPSVLTRSPVGGDTASQRKEVDGVIARGHLGPWARLTLLAQVLIIVTVSSNDGAG
VLSMQPALHTSPTGPESHVTPAPTAWALPSLLHCVAPDLHFQHRQGSGIWARASRSYPGG
QAWLPMAPSTLECAARAQLLRPPWGRTRLARCNCPRERWRNLIRAVAVAEEGTEKENTRS
QLLVWVSVWTAMPFTDRGELGRRCKQCGPGWIQSPGRGVDSGKRCRAGCSVMGKPEQRAA
AAFGRIKTGNCESNWPGGQGGPRATSHFAKHALPSPCIASSLLDPGGGSRSAGQHWAKLR
GESGHFLERHRASSATPQSGPRSTTPQASSLHRSAQRDAAQTASIQLDAPRASSPSQTAQ
RDNPRTSSTQQDTHRASSTQQSTPRTASPSRITQRDNSRTSSTQRSNPRVSSSPRAAQQD
NSRTSSTQQDNPQTSFSACTSQQENSRTSCAQRDNPRASPNRTTQRENSRSSCAQRDNPR
GSSPNRTTQRENSRTSCAQRDNPRGSSPNRTTQRENSRTSCAQKDNPRGSSPNRTTQREN
SRTSCAQRDNPRGPSPNRTTQRENSRTSCAQRDNPRGPSPNRTTQRENSRSSCVQRDNPR
ASSLNRTTQRENSRTSCTQQNTPRTSSTQRNNPQSSSFRRDHPGSSSPQCCTPKNNPRPS
SPHRSTQRNNPRNPSPHRTNKDIPWASFPLRPTQSDGPRTSSPSRSKQSEVPWASIALRP
TQADRPQTSSPTKPAQRDSPQSSSGPPQHSSPARASSSSHNPGPHGAPRTSTPLYLTRGA
SQTSFESSQPPCAVCIGHRDAPRASSPPRYLQYDPFPFFPDPHASESESTHHEPPYIPPA
VCIGHRDAPRASSPPRHTQFDPFPFLPDTSDAENQSPQHDPPQFPPPVCIGYRDAPRASS
PPRQAPEPSLLFQDFPRASTESLVPSTDSLHEPPHIPTPVCIGHRDAPYFTSPPRQAPEP
SLFFQDPPGTSMESLAPSTDSLHGSPMLPPQVCIGHRDAPRASSPPRHPPSDLALLAPSP
PPGSSGGSRGSAPPGETRHNLEREEYTVLADLPPPRRLAQREPGPQGSNGGRTRSPGRAE
VERLFGQERRKSEAPGTFQARDEGRSQRPSQGQSQLLRRQSSPALSREVTTPLAKQAEPA
RRSRAEAPPPRRPGGDLRLQGSSPPPRTSARTSERERRTEKPPERGREGPRQPPGGWQSQ
EELPGAPGPHRHLERGWSSQEEGPGLGGWQGLGEPSGGATRALEGTWRGPLRESEESWGQ
SEAWEKPPSNGVQKPELFGPPQPMSLPENTREGPAEFSNSWRPETDTAMGRGTEGACPHL
HGPERRLELDWRDLLSLLGMPREGAWARPEEPTLASRLPRLDWEGLLELLQAQLPRKDPA
GHWGGPLTAPGPELGSPGTKHALERERQSQPAGWAEATLVNGHSPEQGPQSLAQLPSPAC
TSTQWPKTKVTSGPETSTTAGLETSQLGSRSPAEGPSSADWEVTPEASVEEEPRGDSLTG
QKRADSANKHLEGEAGERGSGCVCVCFQLPSSPPTPLSHATRSLHATRHLGLPDLLNFKK
GWMSILDEPGEPLLPHPADDAQSTSEWKKHWFVLTDSSLKYYRDSTAEEADELDGEIDLR
SCTDVTEYAVQRNYGFQIHTKDAVYTLSAMTSGIRRNWIEALRKTVRPISAPDVTKLSDC
NKENTLHSYSTQKGSLKVGEQRAGSEVISRGSPRKADGQRPSLDYVELSPLSQGSPQRAR
TPARTLDRPAKQEELERDLAHRSEERRKWFEAVDSRATETPAGEGPRRGLGAPLTEDQQS
RLSEEIEKKWQELEKLPLRENKRVPLTALLNQSRGERRGPPSDSHEALEKEVLSLRAQLE
AWRLQGEAPQGAPRSQEDGHIPPGYISQEAWERSLAEMESSHQQVMEELQRHHERELQRL
QQEKEWLLAEETAATASAIEAMKKAYQEELSRELNKTRSLQQGPDGLRKQHQSDMEALKR
ELQVLSEQYSQKCLEIGTLTQQAEEREHTLRCCQQEGQELLRHNQELHARLSEEIDRLRG
FIASQGTGSGCGRNERSSCELEVLLRVKENELQYLKKEVQCLRDELQMMQKDKRFTSGKY
QDVYVELNHIKTRSEREIEQLKEHLRLAMAALQEKEAMRNSVAE
Download sequence
Identical sequences G1PPP7
ENSMLUP00000012996 ENSMLUP00000012996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]