SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013066 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013066
Domain Number 1 Region: 985-1058
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-25
Family SH3-domain 0.00071
Further Details:      
 
Domain Number 2 Region: 1049-1151
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-21
Family SH3-domain 0.00098
Further Details:      
 
Domain Number 3 Region: 1161-1221
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-18
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013066   Gene: ENSMLUG00000014357   Transcript: ENSMLUT00000014364
Sequence length 1222
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429869:3203893:3289161:1 gene:ENSMLUG00000014357 transcript:ENSMLUT00000014364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPDSGGCARKRAAMSVTLTSVKRVQSSPNLLAAGRDSQSPDSAWRSFNDQSQDTLNGDA
TYSSLAAKGFRSVRPNLQEKRSPTQSQVTVNGNSGGAVSPMSYYQRPFSPSAYSLPGSLN
SSIIMPHGRSLDSTEAYAQHAQSLDGTVGSSIPLYRSSEEEKRVTVIKAPHYPGIGPVDE
SGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDDDTDMYNTPYTYNAGLYNSPYSAQSHPA
AKTQTYRPLSKSHSDNGTDTFKDAAPPAPPPHVPPPVPPLRPRDRSSTEKHDWDPPDRKV
DTRRFRSEPRSIFEYEPGKSSILQHERPPPKKALDYVQDHSPGVSNEASLYQSSIDRSLE
RPSSSAGLASDFRKRRKSEPAVGQPRGLGDPRASRTSPGRADLPGSSATLTQSFISSSPS
SPSRAKGLKGGDDSKMCAPLCSCSGPRGRPCQEVDDCPPYRQHLDVPRDSQRALAFKNGW
QMARQNAEVWSSTEEAVSPKIKSRSCDDLLNDDCGGFPDPKAKSESMGSLLCEEDAQEGC
PVPWAPPFLQETATGRSRLRHGSAHNAPGFLKMYKKMHRINRKDLLNSEVMCSVRRVLQY
EQEPHAPGLLHGWSQSSADEVPRDMVPTRISEFEKLIQKSKSMPNLGEELLSPAVLEPQH
HGLGPTRRFSIESLLEEDNPGRHPCPGPRSCTSKTLVPIHIEVTSEEPPRTHLELSDSDQ
DGVVSEHSDCMHVEGSSFCSESDFDHFSFTSSESFYGSSHHHHHHHHHHHHRHLVSSCKG
RCPASYTRFTTMRKHERAKHETTEEPRRHDPDAGLSKLAFLVSPVPFRRKKHSPPKKQTE
KAKCKTAVFEALDSALKDICDQIKAEKRRGSLPDNSILHRLISELLPDVPERNSSLRALR
RSPMPQPCHPLPQDGATHCPWYQSDCGRMPHSASLQDMDTNSNYHPDHDSALGLPDRESP
RSYASTVADLGRSAPRERRGTPEKEKLPAKAVYDFKAQTSKELSFKKGDTVYILRKIDQN
WYEGEHHGRVGIFPISYVEKLSPPEKAQPARPPPPAQPGEIGEAIAKYNFNADTNVELSL
RKGDRVILLKRVDQNWYEGKIPGTNRQGIFPVSYVEVVKRNTAKGAEDYPDPPIPHSYSS
DRIHSLSSNKPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGW
FVGTSRRTKFFGTFPGNYVKRL
Download sequence
Identical sequences G1PPV6
ENSMLUP00000013066 ENSMLUP00000013066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]