SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013073 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013073
Domain Number 1 Region: 144-675,806-1001
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.63e-262
Family Motor proteins 0.00000000154
Further Details:      
 
Domain Number 2 Region: 1659-1848
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000879
Further Details:      
 
Domain Number 3 Region: 1589-1649
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000673
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0061
Further Details:      
 
Domain Number 4 Region: 18-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000062
Family Ras-binding domain, RBD 0.024
Further Details:      
 
Domain Number 5 Region: 998-1050
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000664
Family Motor proteins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013073   Gene: ENSMLUG00000014356   Transcript: ENSMLUT00000014373
Sequence length 2127
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430047:1536595:1608225:1 gene:ENSMLUG00000014356 transcript:ENSMLUT00000014373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNEAGSSGCQRQGAYHLHIYPQLATSESQASCCVTATKDSTTSDVIQDAITSLRLDGT
KRYVLVEVKETGGEEWVLDANDSPVHRVLLWPRRAQDEHPQEDGYYFLLQERDSDGAIKY
VHMQLMAQATAARRLVERGLLPRQQADFDDLCNLPELTEANLLKNLKHRFLQQKIYTYAG
SILVAVNPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVAYYAMLRKRVNQCIVISGE
SGSGKTQTTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVNYLESGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEERQEFQLKQPED
YFYLNQHNLKIEDGEDLKHDFERLKQAMEMVGFLPATKKQIFSVLSAILYLGNVTYKKRA
TGRDEGLEVGPPKVLDTLSQLLKVKREILVEVLTKRKTVTANDKLILPYSLSEAITARDS
MAKSLYSALFDWIVLRINHALLNKKDMEESVSCLSIGVLDIFGFEDFERNSFEQFCINYA
NEQLQYYFNQHIFKLEQEEYQSEGISWHNIDYTDNVGCIHLISKKPTGLFYLLDEESNFP
HATSQTLLAKFKQQHEDNRYFLGTPIMEPAFIIQHFAGKVKYQIKDFREKNMDYMRPDIV
ALLRGSDSSYVRELIGMDPVAVFRWAMLRAAIRAMAVLREAGRLRAERAEKAAANLCSPG
ARSHLGELQRGAITPSEKLYRDLHDQIIKTIKGLPWQGEDPRRLLQSLSRLQKPRTFILK
SKGTKQKQIIPKNLLDSKSLKLIISMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLL
EALGKAEPFFIRCIRSNAEKKELCFDEELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFI
EQFQVLLPKNAQPCREVISALLEKMNVDKRSYQIGKTKVFLKETERQALQETLHREVVRK
ILLLQSWFRMVLERRHFLQMRRAAITIQACWRSYRVRRALERTQAAIYLQATWRGYRHRA
AYRRQRQSIIRLQSLCRGHLQRKSFRQMVAEKQKAEEEREAQQASREETAEGGPSQEPPE
DGEHSPLEPEVWLRHGPPAESVHPEESPSPEKVPLSQKTPPESHEKAPSSREKRESRRQR
GLEHVELQNKHMQSCKDESALREPSGTASPEQEERLPQDRKESREDEALADTGAEAESPA
PENQPGAPPPALPDCMERPTSLALDSGVSAPSPVTTPEKPQDKSKPSGGPRAQDRPLSPG
SSTQIQRYREPVSERLASAVELWRGKNLATGPSAVLSQSLDLSERHRVTGTSLTATEERR
LSLSTSDVSKLLPAQAKTQESVDGEPSTKKAAVQKKKSGDASTCTDSGLSPGSQADSKST
FKRLFLHKNKDKKYSLEGTEEAESSVPGHIVLEAVTMKKNLEAPSGHQHRHATGEKHTKE
TGGKGKKNRNLKIGRITVSEKWRESVFRQITNANELKYLDEFLLNKINDLRSQKTPIESL
FIEATEKFRSNLKTMYSVPNGKIHVGYKDLMENYQIVVSNLAAERGEKDPNLVLNLFQSL
LDEFTRGHSKNDFELPKQSKAQKKKRKQERAVQQHNGHVFASYQVSIPQSCEQCLSYIWL
MDKALICSVCKMTCHKKCMHKIQTYCSYPCGRKSEPGTEPGHFGVCVDSLTSDKASVPIV
LEKLLEHVEMHGLYTEGLYRKSGAANRTRELRQALQTDPSTVKLDNFPIHAITGVLKQWL
RELPEPLMTFAQYGDFLRAVELPEKQEQLAAIYAVLEHLPEANHNSLERLIFHLVKVALL
EDVNRMSPSALAIIFAPCLLRCPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMDEI
SQLEAAESIAFRRLSLLRQNTPWPLKLGFSSPYEGVLNKSPTARGSSSGPEELGVLPEEE
AAGHDEDEDREKEILIERIQSIKEEKEDITYRLPELDPRGSDEENLDSETSASTESLLEE
RAGRGTSEEGPPAPALPCPSAPAPSPLPEVAASPRRRPSSFMTVRVKTPRRTPIMPTANI
KLPPGLPSYLPGQTPGAQEAAMLVRRRETPARRPDQIHSVYITPGAHLPVQGTQEPLDKD
DQPPGAKRRYSDPPTYCLPPTSGQANG
Download sequence
Identical sequences G1PPW3
ENSMLUP00000013073 ENSMLUP00000013073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]