SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013081 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013081
Domain Number 1 Region: 294-480
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-68
Family SPRY domain 0.00000463
Further Details:      
 
Domain Number 2 Region: 8-84
Classification Level Classification E-value
Superfamily RING/U-box 8.62e-22
Family RING finger domain, C3HC4 0.0082
Further Details:      
 
Domain Number 3 Region: 91-153
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000013
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013081   Gene: ENSMLUG00000014383   Transcript: ENSMLUT00000014385
Sequence length 484
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429905:1906921:1911780:-1 gene:ENSMLUG00000014383 transcript:ENSMLUT00000014385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPAALVEAVVEELACPICMAYLREPVSIDCGHSFCHSCLAGLWEVPGESQNWGYTCPLC
RTPVQPGNLRPNWQLANVVEKVCLLGLHPGMGLKGDVCELHGEQLKMFCKEDGLITCETC
SRSSEHEAHSVVPMEDVAWEYKWKLHEALEHLRKEQEEAWKLEVGERKRTATWKIQVETR
KQSIVWEFEKYRQLLKHKPPGQQLEVEAASALASLEREERETRQKLELNHDALIQQSRVL
CRLIAELEERSQRPVRWMLQGIREVLNRSKSWSFQRPEPVSLELKTDCRVPGLREILKTY
AADVHLDPDTAYSRLIVSEDRKCVRYGDTNQKLPDNPERFYRYNIVLGSQCLSSGRHYWE
VEVGDRSEWGLGVCKEDVDRKEVVYLSPNYGFWVIRLRKGNEYRAGTDEYPLLPLPVPPR
RVGVFLDYEAQDISFYNVTDNGSHIFTFPHHPFPGRLLPYFSPCYSIGANNTAPLAICSL
EGED
Download sequence
Identical sequences G1PPW9
ENSMLUP00000013081 ENSMLUP00000013081 XP_006094585.1.53796 XP_014316234.1.53796 XP_014316235.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]