SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013090 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013090
Domain Number 1 Region: 123-389
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.78e-51
Family Nuclear receptor ligand-binding domain 0.0000197
Further Details:      
 
Domain Number 2 Region: 55-135
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.87e-31
Family Nuclear receptor 0.0000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013090   Gene: ENSMLUG00000014386   Transcript: ENSMLUT00000014396
Sequence length 407
Comment pep:novel scaffold:Myoluc2.0:GL430047:1619060:1628348:-1 gene:ENSMLUG00000014386 transcript:ENSMLUT00000014396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVTGGWGGPGGGDTNGVDKAGGYPRAAEEDSASPPGAASDAEPGDEERPGLQVDCVVC
GDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRV
GMRKEAVQRGRIPHSLPGAVAASSGSPPGSVLAAAVAGGDLFPGQPVSELIAQLLRAEPY
PAAAGRFGGGGGSSGAVLGIDNVCELAARLLFSTVEWARHAPFFPRPAGRPTKMTLACAL
SWSELFVLNAGARCPLHTAPLLAAAXAAPMTRNARGFMDQVRAFQEQVDKLGRLQVDSAE
YGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALR
AVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSETVKCL
Download sequence
Identical sequences G1PPX6
ENSMLUP00000013090 ENSMLUP00000013090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]