SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013179 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013179
Domain Number 1 Region: 4-116
Classification Level Classification E-value
Superfamily PH domain-like 9.04e-38
Family Pleckstrin-homology domain (PH domain) 0.00000122
Further Details:      
 
Domain Number 2 Region: 193-255
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-16
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013179   Gene: ENSMLUG00000014485   Transcript: ENSMLUT00000014489
Sequence length 257
Comment pep:novel scaffold:Myoluc2.0:GL429819:4038970:4102702:1 gene:ENSMLUG00000014485 transcript:ENSMLUT00000014489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNQFPPVAAQDLPCVFKAGYLEKRRKDHSFLGFEWQKRWCALSKGVFYYYGSDKDKQQKG
EFAIDGYHVRMNNTLRKDAKKDCCFEISAPDKRVYQFTAASPKDAEEWVQQLKFLLQDMG
SDIIPEEDEEGGELYDDVDHPLPTSSSLASSQPIDDEIYEELPDEEEEAAPGKVEEQRKM
SQDSGHHSTGDKSTDYANFYQGLWDCTGALSDELSFKRGDVIYILSKEYNRYGWWVGEMK
GAIGLVPKAYIMEMYDI
Download sequence
Identical sequences G1PQ51
ENSMLUP00000013179 ENSMLUP00000013179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]