SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013213 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013213
Domain Number 1 Region: 621-913
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.66e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000785
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-40
Family Third domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 3.66e-37
Family Second domain of FERM 0.0000724
Further Details:      
 
Domain Number 4 Region: 27-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.6e-22
Family First domain of FERM 0.0011
Further Details:      
 
Domain Number 5 Region: 510-604
Classification Level Classification E-value
Superfamily PDZ domain-like 1.86e-20
Family PDZ domain 0.00000989
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013213   Gene: ENSMLUG00000014518   Transcript: ENSMLUT00000014525
Sequence length 926
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430014:1111067:1282752:-1 gene:ENSMLUG00000014518 transcript:ENSMLUT00000014525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRFRLPAGRTYNVRASELARDRQHTEVDCNILLLDNTVQVFKVSKHDQGQVLLDIVFK
HLDLTERDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPYNTAALLASFAVQSEFGDYNQSENLPGYLSDYSFIPNQ
PQEFEKEIAKLHQQHTGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGG
ILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSVSDDRLETQSLPSRSPPGTPNHRNSAFTQEGPRLRPSSVGHLV
DRVVHTSPSEVFVNHRSPSSTQANSIILESSPSQETPGDGQPPALPPKQSKKNSWNQMYY
SHSQQDLENHINEAFDVPSSPEKSTPNGGIPHDHLVLIRMKPDENGRFGFNVKGGYDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELVLL
VRPNAVYDVVEEKLETEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLTQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSII
NQYIACQGPLPHTCTDFWRMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQ
VTCHSEEGNTAYIFRKMTLFNQEKNESRQLTQIQYTAWPDHGVPDDSSDFLDFVCHVRNK
RAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YRFVCEAILKVYEEGFVRPLTTSSNK
Download sequence
Identical sequences G1PQ78
ENSMLUP00000013213 ENSMLUP00000013213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]