SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013237 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013237
Domain Number 1 Region: 4580-4716
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.85e-36
Family Synaptotagmin-like (S variant) 0.000000716
Further Details:      
 
Domain Number 2 Region: 4896-5026
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.15e-20
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Domain Number 3 Region: 4379-4476
Classification Level Classification E-value
Superfamily PDZ domain-like 1.62e-19
Family PDZ domain 0.00000659
Further Details:      
 
Domain Number 4 Region: 929-1045
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000935
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.016
Further Details:      
 
Domain Number 5 Region: 499-569
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000878
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013237   Gene: ENSMLUG00000014524   Transcript: ENSMLUT00000014549
Sequence length 5030
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429818:2681620:2955247:1 gene:ENSMLUG00000014524 transcript:ENSMLUT00000014549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNEASLEGEGLPEGLAAAAAAAAAGAGAGGAGSPLHTVIPAGMEADLSQLSEEERRQIA
AVMSRAQGLPRGSVPAAAAEPPPMHRKQEFDSSHPPKPPGKPPDPGRPAQPGLSKSRTTD
TLRSEQKLPGRSPSTISLKESKSRTDLKEEHKSGMMPGFLSEVNPLSAVSSVVNKFNPFD
LISDSDASQEETAKKQKIAQKEQGKPEGITKPPSQQQSPKSVPKQQGPVRAPHQQDGSPK
SVSSQQPEKVKSQPPGTGKPIQQSPSKPPTQQASPGKPPAQQPGPEKFSTPQPGPAKPSA
QQPGPAKSPAQPPGPAKPPAQQTGPPKSLAHQPGPQSPAQPPGPTKTPPGPAKPSAQQPG
PAKPSAQQPGPAKPSAQQPGPAKPSAQQPGPAKPSAQQPGPAKPSAQQPGPAKPSAQQPG
PAKPSAQQPGPAKPSAQQPGPAKPSAQQPGPAKPSAQQPGPAKPSVQQPGSAKPSAQQST
KPVSQTGAGKPLQPPTSPSAAQIPVQGIPKTICPLCNTTELLLHVPEKANFNTCTGCKTT
VCSLCGFNPNPDITEVKEWLCLNCQMQRALGGDLAPIPSSPQPKPKTAAGILASVVSKPS
PQSQQVSPKKDTVPKQDISKAPESKKPPPLVKQPTLHGSPPVTAKQPHVAESSPKPATPK
EPSVPSELAKGPMADDKPKQPKMAKPATDIVSSSSTATKPDIPSSKVQSQDQEKTTPPLK
TDSAKPSQSFPPTGEKVTPFDSKVIPRPASDSKIISQPGPGMESKGKKQVDPVQKKEEPK
KAQTKISPKPDAKPVPKGSPTPSGPRPTPGQTAPPSPQPPKPQEQSRRFSLNLGSITDAP
KSQPTTPQETMTGKLFGFGASIFSQASNLISTAGQPGSHPQSGPGGPAKQVPPPAQPPPS
QGPPKSTGQVPPAPAKVLPVKKETKAPGAEKLEPKAEQVSTVKRTETEKKPQPIKDGKPS
TAEPPKAALPPKLEKPPKPESACPLCKTELNIGSTEPPNFNTCTECKHQVCNLCGFNPTP
HLTEIHEWLCLNCQTQRAMSGQLGDMGKMPPAPSGPKASPMPFPTEQSPQKTAMPGQGKV
KKKEQEGKTEGEKIIPEKVKETPLFEKMLPKVTTDKKQEERKQEKDQALAPQEKKATPED
KKPPPEEDKKPPPEEKKPPPKDKKPTPEDKKFPPGAKTSALEEEQKQTLLKTQVQVAEET
PEDRVAPQAVQEKKPSPMKMEDVPPGMLQTLPEGDDGATQKIKDQPQEVCAAKPDQVEPG
KEKTEKEDDKSDTSSSQQPKSPQGLSDTGYSSDGISGSLGEIPSLIPSDEKDLLKGLKKD
SFSQESSPSSPSDLAKLESTVLSILEAQASTLIEEKSEKKTQPQEVSPEQPKEEQKTQSL
TQSLETTVSEEKLKESHEAKDTFTKDGQQDTPPRKDHKEKSEFVDDIATRRQPYDSVEDS
SESENSPVPQRKRRTSVGSSSSDEYKQEDSQGSGEEEDFIRKQIREMSADEDASGSEDDE
FIRNQLKQISGIIESQKKEETKGKGKVTAGKHKRLTRKSSTSFEEDAGRRHSWHDEDDET
FDESPDIKYRETKSQESEELVVAGGGGLRRFKTIELNSTIADKYSAESSQKKTALYFDEE
PELEMESLTDSPEDRSRGEGSSSLHASSFTPGTSPTSVSSLDEDSDSSPSHKKGESKQQR
KARHRSHGPLLPTIEDSSEEEELREEEELLKEQEKQRELEQQQRKSSSKKSKKDKDELRA
QRRRERPKTPPSNLSPIEDASPTEELRQAAEMEELHRSSCSEYSPSIESDPEGFEISPEK
IIEVQKVYKLPTAVSLYSPTDEHSVMQKEGGQKALKSAEEMYEEMMHKTHKYKAFPAANE
REEMFEKEPLYGGMLIEDYIYESLVEDTYNGSVDDSLLTRQEDENGFMQQRGREQKTRLP
EHIYDDPMQKITDLQKEFYELESLHSIVPQEDVVSSSYIIPESHEIVDLDSMVTSTSEEK
KLLDADAAYEELMKRKQMQLTPESSPTQPPIRDDMTESTMDYDRLPDESLTSSILSGASL
TDSTSSATLSIPDVKITQHFSTEEIEDEYITDYTREIQEIIAHESLILTYSEPSESATSV
PPSDTPSLTSSVSSVCTTDSSSPVTTLDSITTVYTEPVDIVTKLEDPGDISSSTYFQGSI
IDYPEEISISLDQTTIPDGRPSTDHIAISLSDMTPSILESEETKPKGLIADTISTDLSIS
EKDSVKKAKKETGNGIILEVLEAYRDKRKDSEAELAKTSLSETVFDQPPSGIAFPMKEQV
STACFVSGEIFGQAKPASQIPSGGPSVSSLPTKTHPFLRSSSLDTSAQPPPPPPPPLPPH
PLPSSSLSKLPPATAPYCGKPIDTAEDHRFNRKVFTAVTSTLVFPILRIRPTEITFLLIL
PIAPKPPITQHPGTTQKPTDTHPKPTGLSSNMTLNLVTTADYKLPSPTSPLSPHSNKSSP
RFSLMETYVVITLPSEPGTPTDSSSQAITSWPLGSPLKHTIATEPVFSVVPPVTAAEMSY
SSEQSLYISGALETFSAIPVTTLSSCQAAPISVTQFPITEVSKAEISATRSTVPSVGLSS
VSVPIPPEPLALDTLHLEKHQQKENGKLQLIGDAIDLRTAPKVEVKVTEKCMDLSASAMD
VKRQTTTKEAYGRQISAVQPSIINLSATSSVVTPISLVTEAVTAVTCTASASYAAGTESL
VSIEHATATPLQLTTSKHTEPPYRIPSGQSFPTVKQEAPINLSLSTSAQAMTLATTKPIT
VPPVGVTNGWTDSTTSQGITDGEAVDLSTTKSHRTVVTMDESTSSVVTKIIEDDEKPVDL
TAGRRAVCCDVVYKLPFGRSCTAQQPATTLPEDRFGYRDDHYQYDRSGPYGYRGVGGMKP
SMSDTNLAEAGHFFYKSKNAFGYSGETDAAVDLTSGRSSTGEVMDYSSKTAGPYPETRQV
ISGIGISTPQYSTARMTPPPGSQYGVGSVLRSTNDVVYSSEATPVPSTFAITTQPGSIFS
TTVRDLSGVHTTDGVTSFSTLHQSQPMPRSYFLTTGASETDIVVTGIDINASLQTIAMET
LTTETIDSVPTLTTASEVFPEVTGDESALLIVPEEDKQQQQLDLERELLELEKIKQQRFA
EELEWERQEIQRFREQEKMMVQKKLEELQSMKQHLLYQQEEERQAQFMMRQETLAQQQLQ
LEQIQQLQQKLHQQLEEQKIRQIYQYNYDPSGTATPQTTTEQAMLEGQYAAPEGGQFWAA
EDATTTASAVVAIEIPQSQGWYTVQSDGVTQYIAPPGILSTVSEIPLTDVVVKDEKQPKK
RSSGAKVRGQYDEIGENMAEDPRCFKKIVDSGVQTDDEDAADRSYASRRRKTKKSVDTSV
QTDDEDQDEWDMPTRSRRKTRVAKYGDGTTEAEKTKPLSKVSSIGVQTVAEISVQTEPVG
TIRTPSIRAHVDAKVEIIKHISAPEKTYKGGSLGCQTEADSETQSPQYLSATSPPKDKKR
PTPLEIGYSSHLRPDSTQQLAPSPPKSPKVLYSPISPLSPGKALESAFVPYEKPLPDDIS
PQKVLHPDMAKVPPASPKTAKMMQRSMSDPKPLSPTADESSRAPFQYTEGYTTKSSQTIT
PSGTQKKVKRTLPNPPPEETSTGTQSTYSPMGTVSRRRICRTNTMARAKILQDIDRELDL
VERESAKLRKKQAELDEEEKEIDAKLRYLEMGINRRKEALLKEREKRERAYLQGVAEERD
YMSDSEVSSTRPSRIESQHGIERPRTAPQTEFSQFIPPQTQTESQLVPPTSPYTQYQYSS
PALPTQAPTPYTQQSHFQQQTLYHQQVSPYQTQPTFQAVATMSFTPQAQPTPTPQPSYQL
PSQMMVIQQKPRQTTLYLEPKITSNYEVIRNQPLMIAPVSTDNTYAVSHLGSKYNTLDLR
MGLEERSSMASSPISSISADSFYADIDHHTSRNFVLIDDIGEISKGTAALTTAFNLHEKD
LSKTDRLLRTTETRRSQEVTDFLAPLQTSSRLHSYVKAEEDPMEDPYELKLLKQQIKQEF
RRGAENLDHLAGLSHYYHGDTTYRHFPKSEKYSISRLTLEKQAAKQLPAAILYQKQSKHK
KSLIDPKISKFSPIQESRDLEPDYSSYMTSGTSSIGGISSRARLLQDEITYGLRKNITDQ
QKFVGSSLGTGLGTLGNTIRSALQDEADKPYSSGSRSRPSSRPSSVYGLDLSIKRDSSSS
SLRLKAQEAEALDVSFSHASPSGRTKPTSLPISQSRGRIPIVAQNSEEESPLSPVGQPMG
MARAAAGPLPPISADTRDQFGSSHSLPEVQQHMREESRTRGYDRDIAFIMDDFQHAMSDS
EAYHLRREETDWFDKPRESRLENGHGLDRKLPERLVHSRPLSQHQEQIIQMNGKTVHYIF
PHARIKITRDSKDHTVSGNGLGIKIVGGKEIPGHSGEIGAYIAKILPGGSAEQTGRLMEG
MQVLEWNGIPLTSKTYEEVQSIISQQSGEAEICVRLDLNMLSDSENPQHLELHEPPKSVD
KAKSPGVDPKQLAAELQKVSLQQSPLVMSSVVEKGSHAHSGPTSAGSSSVPSPGQPGSPS
VSKKKHSSSKPTDATKVVSHPITGEIQLQINYDLGNLIIHILQARNLVPRDNNGYSDPFV
KVYLLPGRGQVMVVQNASAEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLKKKTLEVTVW
DYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTESIDHGKSHSGQSSQQSPKPSVI
KSRSHGIFPDPSKDMQVPTIEKSHSSPGSSKSSSEGHLRSHGPSRSQSKTSVTQTHLEDA
GAAIAAAEAAVQQQRLQPTKPTNHRPAESSVSTGSSGSSFGSGYSVDSEGSSSTAGETNL
FPIPRIGKMGHNGQDPIKQPGVGVGLSDTEVKTQVMGEIKIALKREMKTDGEQLIVEVLQ
CRNITYKFKSPDHLPDLYVKIYVMNISTQKKVIKKKTRVCRHDREPSFNETFRFSLSPAG
HSLQVLLFSNGGKFMKKTLIGEACVWLDKVDLRKRIVNWHKLLANSTQTH
Download sequence
Identical sequences G1PQ97
ENSMLUP00000013237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]