SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013239 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013239
Domain Number 1 Region: 129-215
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.44e-24
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0057
Further Details:      
 
Domain Number 2 Region: 77-146
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000000000314
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.017
Further Details:      
 
Domain Number 3 Region: 27-80
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000000222
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013239   Gene: ENSMLUG00000014549   Transcript: ENSMLUT00000014551
Sequence length 251
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431606:23671:31276:1 gene:ENSMLUG00000014549 transcript:ENSMLUT00000014551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPPGGLPDVSQAACATCSPAHPSRYPGYGVYTYPNSFFRYEGEWKGGKTHGRGKLLFKDG
SYYEGEFADGEIVGQGRRHWAATGNTYSGQFVFGEPQGHGVMEYKAGGRYEGELCHGVRE
GHGRLVDQDGRVYWGSFHNNKRHGRGHMAFPNGDEYEGDWVRDQRQGHGVLRCADGSTYE
GQWHSDVRSGLGSMAHCSGLVYRGMWINGHPVGRAVRTVVLGPEVMDVARGACFTVRVQL
LQDNGAVATSK
Download sequence
Identical sequences G1PQ99
ENSMLUP00000013239 ENSMLUP00000013239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]