SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013262 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013262
Domain Number 1 Region: 171-438
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.24e-81
Family Protein kinases, catalytic subunit 0.000000162
Further Details:      
 
Domain Number 2 Region: 74-210
Classification Level Classification E-value
Superfamily SH2 domain 4.01e-33
Family SH2 domain 0.0000105
Further Details:      
 
Domain Number 3 Region: 11-93
Classification Level Classification E-value
Superfamily SH3-domain 1.18e-17
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013262   Gene: ENSMLUG00000014570   Transcript: ENSMLUT00000014576
Sequence length 450
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430322:20158:26906:-1 gene:ENSMLUG00000014570 transcript:ENSMLUT00000014576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSRGRARLGPQYVGLWDFKARTNEELSFRAGDLFHVARKEEEWWWATLLDAEGGALAEG
YVPHNYLAERETVESEPWFFGCISRLEALHRLQADGTEPGAFLIRVSEKPGADYVLSVRD
RQAVRHYRIWRCAGRLHLSEAVSFPSLAQLVGHHQAHSLSKGLRLTVPCWKHEREPLPLC
ADWERPREEFTLCRKLGAGYFGEVFEGLWKGQVRVAIKVIARDDLLHQHTFQSEIQAMKK
LRHKHILALYAVASVGDPVYIITELMAKGSLLELLRESDEKALPVLELVDIASQVAEGMC
YLESQNYIHRDLAARNILVGENNICKVGDFGLARLIKEDIYLSHDRNIPYKWTAPEALSR
GHYSIKSDVWSFGVLLHEIFSRGQTPYPGMSNHEAFMRVDSGYRMPCPPECPPSAHRLML
ACWHRSPEQRPCFRALREKLCSFTSYENPI
Download sequence
Identical sequences G1PQC0
ENSMLUP00000013262 XP_006104261.1.53796 ENSMLUP00000013262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]