SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013267 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013267
Domain Number 1 Region: 227-493
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-77
Family Protein kinases, catalytic subunit 0.000000218
Further Details:      
 
Domain Number 2 Region: 127-259
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-36
Family SH2 domain 0.00021
Further Details:      
 
Domain Number 3 Region: 49-173
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000263
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013267   Gene: ENSMLUG00000014577   Transcript: ENSMLUT00000014582
Sequence length 502
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430322:29539:36113:-1 gene:ENSMLUG00000014577 transcript:ENSMLUT00000014582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRFRTPWNMEPFLRKRLAFLSFFWNKIWPAGAQDHSIPCFPDPGADPELEPPAAVLGSPP
APGQFFRALCDFTARYADELSVSRGDRLYALKEEGDYIFARRLSGQPSVGLVPLAYVAKA
TAEMFADQPWYFSGISRTQAQQLLLSPANVPGAFLIRPSESSQGDYSLSVRAQAKVRHYR
ISTAADGSFYLQKGRLFPSLGELLTYYKANWKLIQNPLLQPCVSQKPPEQDAWERPRSEF
TLRRKLGKGYFGEVWEGLWLGSVPVAIKVIKSANMKLADLAKEIQTLKSLRHARLIQLHA
VCSTGEPVYIVTELMRKGNLQAFLGSPEGRALNPPVLLGFACQVAEGMRYLEERRIVHRD
LAARNVLVDDDLACKVADFGLARLLKDDIYSPSSGSKIPVKWTAPEAAHYRVYSPKSDVW
SFGVLLYEVFSYGQCPYEGMSNHETLQQIERGYRLPRPAACPAEAYVLMLACWKGSPEER
PAFAMLQATLGTIHRRLHPTLT
Download sequence
Identical sequences G1PQC5
ENSMLUP00000013267 ENSMLUP00000013267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]