SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013277 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013277
Domain Number 1 Region: 387-607
Classification Level Classification E-value
Superfamily VPS9 domain 1.57e-35
Family VPS9 domain 0.0012
Further Details:      
 
Domain Number 2 Region: 67-191
Classification Level Classification E-value
Superfamily SH2 domain 8.21e-16
Family SH2 domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013277   Gene: ENSMLUG00000014584   Transcript: ENSMLUT00000014592
Sequence length 784
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430140:628884:633296:-1 gene:ENSMLUG00000014584 transcript:ENSMLUT00000014592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTPGEPGAGPLGAPSPSNASAPGHLEREKPAQDPMYDVPDASGGRTGGPQRPGRTVSLR
ERLLLTRPVWLQLRANAAAALHVLRTQPPGTFLVRKSNTRQCQALCVRLPEASGPSFVSS
HYIQERPAGISLEGSELVFPDLVQLICAYCHARDILLLQLQLPRAIRQAATHKELEAISH
LGVEFWSSSLNTKAQPGPSEGPLLPRLKPRSPQELDQGTGAALCFFNPLFPGDLGPTKRE
KFKRSFKVRVSTETSSPLSPPAVPPPPVPVPPGAAPSQTERMPPRQLLRRESSAGYRVPG
GASPSLPPLPSLQEVDCGSPSSSEEEEGMQGHQGSPATSPRLSLRNRRRPLLRSMSSAFC
SLLAPERQVDRAASALMQDRHTAVGQLVQDLLTQVRAGPEPQELQGIREALSRAQAMLSA
ELGPEKLLPPNRLERVLEKSLHRSVLKPLRPILVARLRRRLSADGSLGHLAEGFRLARAQ
GPAAFGSRLSLPSPVETEQVRQKLLQLLRTYSPNAQVKRLLQACKLLYTVLRTHLGEGAG
ADEFLPLLSLVLAHCDLPELLLEAEYMSELLEPTLLTGEGGYYLTSLSASLALLSGLGQA
HKLPLSPSQELQRSLSLWEQRRLPATHSFQHLLRVAYQDPSSGCTSKTLAVPPGASIATL
NQLCATKFRVTQPDAFGLFLYKEQDYHRLPPGALAHRLPTTGYLVYRRQAERPETLGASL
GGATEEGSGEPEAGGREEKGGREMGISKSKPVPVTTAKQEESQVRGGPAQPSALEAEGGQ
AAEE
Download sequence
Identical sequences G1PQD3
ENSMLUP00000013277 XP_014322497.1.53796 ENSMLUP00000013277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]