SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013294 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013294
Domain Number 1 Region: 942-1047
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-27
Family PDZ domain 0.0000154
Further Details:      
 
Domain Number 2 Region: 234-340
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-25
Family PDZ domain 0.00000482
Further Details:      
 
Domain Number 3 Region: 727-833
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-23
Family PDZ domain 0.00000971
Further Details:      
 
Domain Number 4 Region: 581-684
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-22
Family PDZ domain 0.0000166
Further Details:      
 
Domain Number 5 Region: 408-512
Classification Level Classification E-value
Superfamily PDZ domain-like 8.68e-19
Family PDZ domain 0.0000126
Further Details:      
 
Domain Number 6 Region: 123-159
Classification Level Classification E-value
Superfamily WW domain 0.000000000000727
Family WW domain 0.0013
Further Details:      
 
Domain Number 7 Region: 169-204
Classification Level Classification E-value
Superfamily WW domain 0.00000000167
Family WW domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013294   Gene: ENSMLUG00000014602   Transcript: ENSMLUT00000014610
Sequence length 1101
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429785:12439959:12779142:-1 gene:ENSMLUG00000014602 transcript:ENSMLUT00000014610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FADNYYGTPKPPAEPAPLLLNVTDQILPGATASAEGKRKRNKSVSNMEKASIEPPEEEEE
ERPVVNGNGVVVTPESSEHEDKSAGASGETPSQPYPAPVYSQPEELKEQMDDAKPTKPEE
NEESDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKI
DDPIYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTDLGTKPLQAPGFREKPLFTRDA
SQLKGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYIN
EVCVLGHTHADVVKLFQSVPIGQSVSLVLCRGYPLPFDPEDPANSLVPPLAIMERPPPVM
VNGRHNYETYLEYISRTSQSVPDITDRPPHSLHSMPADGQLDGTYPPPVHDDNVSMASSG
ATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNL
SHTEVVDILKDCPIGSETSLIIHRGGFFSPWKSPKPIMDRWENQGSPQTSLSAPAIPQNL
PFPPALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSSGPDYKEL
DVHLRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKT
HRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSN
HAAPSGSASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRI
IDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPAS
APSSEKQSPMAQQHSPLAQQSPLAQPSPATPNSPVTQPAPPQPLQLQGHENSYRSEVKAR
QDVKPDIRQPPFTDYRQPPLDYRQPPGGDYQQPPPLDYRQHSPDTRQYPLSDYRQPQDFD
YFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRD
MTHARAIELIKSGGRRVRLLLKRGTGQVPEYGMVPSSLSMCMKSDKHGSPYFYLLGHPKD
TVYSNKTPLAIPVFPSLLCGN
Download sequence
Identical sequences G1PQF0
ENSMLUP00000013294 ENSMLUP00000013294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]