SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013318 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013318
Domain Number 1 Region: 30-269
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.9e-36
Family Ankyrin repeat 0.00052
Further Details:      
 
Domain Number 2 Region: 287-333
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000085
Family SOCS box-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013318   Gene: ENSMLUG00000014634   Transcript: ENSMLUT00000014638
Sequence length 334
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430660:124034:136975:-1 gene:ENSMLUG00000014634 transcript:ENSMLUT00000014638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGGPDGRAGPGPAGPNLKEWLREQFCDHPLEHCEDTRLHDAAYVGDLQTLRSLLQEE
SYRSRINEKSVWCCGWLPCTPLRIAATAGHGNCVDFLIRKGAEVDLVDVKGQTALYVAVV
NGHLESAQILLEAGADPNGSRHHRSTPVYHASRVGRADILKALIRYGADVDINHHIFPDI
RPPFSRRLTSLVVCPLYISAAYHNLQCFKLLLQAGANPDFNCNGPVNTQGFCRGSPGCVM
DAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPESRRRKVDPEALQVFKEARSVPRALLN
LCRVAVRRALGKYRLHLIPSLPLPDPIKKFLLYE
Download sequence
Identical sequences G1PQG7
ENSMLUP00000013318 ENSMLUP00000013318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]