SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013327 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013327
Domain Number 1 Region: 70-175
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-37
Family Second domain of FERM 0.0000377
Further Details:      
 
Domain Number 2 Region: 173-319
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-36
Family Third domain of FERM 0.00071
Further Details:      
 
Domain Number 3 Region: 2-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-17
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013327   Gene: ENSMLUG00000014639   Transcript: ENSMLUT00000014648
Sequence length 655
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:13862484:13986030:1 gene:ENSMLUG00000014639 transcript:ENSMLUT00000014648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQKSTRGSVVLDHVFRHINLVEIDYFGLRYCDRSHQTYWLDPAKTLAEHKELINTGPPYT
LYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPASTAAQLGAYAVQSELGDYD
PYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLMGQAPSEAELNYLRTAKSLEMYGVDLH
PVYGENKSEYFLGLTPVGVVVYKNKKQVGKYFWPRITKVHFKETQFELRVLGKDCNETSF
FFEARSKTACKHLWKCSVEHHTFFRMPENESNSMSRKLSKFGSMSYKHRYSGRTALQMSR
DLSIQLPRPDQNVARSRSKTYPKRIAQTQPAGSNSINRVTANTENGENEGTTKIIAPSPI
KSFKKAKNENSPDIQRSKPHAPWEENGPQSGLYNSPHDRTKSPKFPCARRRNPSCGSDND
SVQPTRRRKAHNSGEDSDLKQRRRSRSRCNTSSGSESENSNREHRKKRNRIRQENDMVDS
APQWEAVLRRQKEKNQADPNNRRSRHRSRSRSPDIQAKEELWKHIQKELVDPSGLSEEQL
KEIPYTKVETQGDPIRIRHSHSPRSYRQYRRSQCSDGERSVLSEVNSKTDLVPPLPVTRS
SDAQGSGGSTVHQRRNGSKDSLIEEKSQTSTSNLAGKHIAKTIKTIQASRLKIET
Download sequence
Identical sequences G1PQH3
ENSMLUP00000013327 ENSMLUP00000013327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]