SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013345 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013345
Domain Number 1 Region: 316-489,518-579
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.35e-44
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 583-768
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.1e-43
Family cAMP-binding domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013345   Gene: ENSMLUG00000014660   Transcript: ENSMLUT00000014667
Sequence length 1075
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430103:574849:588973:1 gene:ENSMLUG00000014660 transcript:ENSMLUT00000014667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVPHSTGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEKDMVGSPAHDTNHRGPPTSWLA
PGRAKTFRLKLPAMLALTARESSGRPGRTGTGGAGAAGAVVVDVDLDLTPAAPSSESLAL
DEVPAMDNHVAGLRPTEEQRALVAPSSPPSCKPGPHPSPQAPQAPQAQGLNPEASGSTCS
LARTRSRESCASVRRASSADDIEAMRAGVLPPPPRHASTGAMHPLRSGLLNSTSDSDLVR
YRTISKIPQITLNFVDLKGDPFLASPSSDREIIAPKIKERTHNVTEKVTQVLSLGADVLP
EYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEEGPVAPDCG
YACQPLAVVDLIVDIMFIVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAI
PFDLLIFGSGSEELIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLAC
IWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVG
FGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRF
HQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGA
TKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDIVVAILGKNDIFG
EPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRDTN
MIPGSPGSAELEGGFNRQRKRKLSFRRRTDKDPEQPGEVSALGPGRVGAAPSGRGRPGGP
WGESPSSGPSSPESSDDEGPGRSSSPLRLVPFSSPRPPGELPGGEPLTEDCEKSSDTCNP
LSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPTPAPSLLNIPLSSPGRRSRGDVESRLDA
LQRQLNRLETRLSADMATILQLLQRQMTLVPPTYSAVTTPGPGPTSTCPLLPVSPIPTLT
QYSLSQVSQFMVCEELPPGGPELPQDGPTRRLSLPGQLGALTSQPLHRHGSDPGS
Download sequence
Identical sequences G1PQI6
ENSMLUP00000013345 ENSMLUP00000013345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]