SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013390 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013390
Domain Number 1 Region: 84-95,186-420
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.34e-50
Family Nuclear receptor ligand-binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 11-93
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013390   Gene: ENSMLUG00000014714   Transcript: ENSMLUT00000014717
Sequence length 434
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429940:1373824:1403212:1 gene:ENSMLUG00000014714 transcript:ENSMLUT00000014717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVSVPDDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSR
KQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISEEEIERIMSGQEFEEEA
NHWSNHGDSDHSSPGNRASESNQPSPGSTMSSSRSVELNGFMAFREQYMGMSVPPHYQYI
PHLFSYSAHSPLLPPQARSLDPQSYSLIHQLVSAEDLEPLGTPMLIEDGYAVTQAELFAL
LCRLADELLFRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGELAD
VTAKYSPSDEELHRFSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLT
SASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLPLLF
KVVLHSCKTSVSKE
Download sequence
Identical sequences G1PQM4
ENSMLUP00000013390 ENSMLUP00000013390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]