SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013425 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013425
Domain Number 1 Region: 308-593
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.88e-71
Family Protein kinases, catalytic subunit 0.00000000788
Further Details:      
 
Domain Number 2 Region: 20-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.69e-22
Family Ras-binding domain, RBD 0.0000227
Further Details:      
 
Domain Number 3 Region: 92-144
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000015
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013425   Gene: ENSMLUG00000014746   Transcript: ENSMLUT00000014755
Sequence length 613
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429963:358546:368963:1 gene:ENSMLUG00000014746 transcript:ENSMLUT00000014755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIEGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNCRHLMPSRYYHSIQDLSGGYRQHEAPSNRS
LNEPLTPQGSSSSSQHRDPEHFPFPATANAPLQRIRSTSTPNVHMVSTTTPLDSSLIQLA
AQSFNAEATAAGSRGGSDGVPRGSPSPASVSSGRKSPHSKSPSEQRERKSLADDKKKVKN
LGYRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKN
EMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQT
AQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWM
AAEVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSK
ISSNCPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADE
LPACLLSAARLVP
Download sequence
Identical sequences G1PQP9
ENSMLUP00000013425 ENSMLUP00000013425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]